PDB entry 3nwn

View 3nwn on RCSB PDB site
Description: Crystal structure of the human KIF9 motor domain in complex with ADP
Class: contractile protein
Keywords: kinesin, motor domain, ADP, Structural Genomics, Structural Genomics Consortium, SGC, CONTRACTILE PROTEIN
Deposited on 2010-07-09, released 2010-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin-like protein KIF9
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nwna_
  • Heterogens: MG, CL, ADP, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nwnA (A:)
    mgsshhhhhhssglvprgsmgtrkkvhafvrvkptddfahemirygddkrsidihlkkdi
    rrgvvnnqqtdwsfkldgvlhdasqdlvyetvakdvvsqaldgyngtimcygqtgagkty
    tmmgatenykhrgilpralqqvfrmieerpthaitvrvsyleiyneslfdllstlpyvgp
    svtpmtivenpqgvfikglsvhltsqeedafsllfegetnriiashtmnknssrshcift
    iyleahsrtlseekyitskinlvdlagserlgksgsegqvlkeatyinkslsfleqaiia
    lgdqkrdhipfrqcklthalkdslggncnmvlvtniygeaaqleetlsslrfasrmklv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nwnA (A:)
    kkvhafvrvkptddfahemirygddkrsidihlkkdirrgvvnnqqtdwsfkldgvlhda
    sqdlvyetvakdvvsqaldgyngtimcygqtgagktytmmgatenykhrgilpralqqvf
    rmieerpthaitvrvsyleiyneslfdllstlpyvgpsvtpmtivenpqgvfikglsvhl
    tsqeedafsllfegetnriiashtmnknssrshciftiyleahkyitskinlvdlagsey
    inkslsfleqaiialgdipfrqcklthalkdslggncnmvlvtniygeaaqleetlsslr
    fasrmklv