PDB entry 3nwj

View 3nwj on RCSB PDB site
Description: Crystal structure of shikimate kinase from Arabidopsis thaliana (AtSK2)
Deposited on 2010-07-09, released 2011-06-29
The last revision was dated 2011-06-29, with a file datestamp of 2011-06-24.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.194
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AtSK2
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At4g39540, At4g39540/F23K16_170
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: AtSK2
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At4g39540, At4g39540/F23K16_170
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nwjA (A:)
    gshmrlrsvsdknssalletgsllhspfdeeqqilkkkaeevkpylngrsmylvgmmgsg
    kttvgkimarslgytffdcdtlieqamkgtsvaeifehfgesvfreketealkklslmyh
    qvvvstgggavirpinwkymhkgisiwldvplealahriaavgtgsrpllhddesgdtyt
    aalnrlstiwdargeaytkasarvslenitlklgyrsvsdltpaeiaieafeqvqsylek
    edgmarpdgl
    

    Sequence, based on observed residues (ATOM records):
    >3nwjA (A:)
    qqilkkkaeevkpylngrsmylvgmmgsgkttvgkimarslgytffdcdtlieqamkgts
    vaeifehfgesvfreketealkklslmyhqvvvstgggavirpinwkymhkgisiwldvp
    lealahriaatytaalnrlstiwdargeaytkasarvslenitlklgyrsvsdltpaeia
    ieafeqvqsyleke
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nwjB (B:)
    gshmrlrsvsdknssalletgsllhspfdeeqqilkkkaeevkpylngrsmylvgmmgsg
    kttvgkimarslgytffdcdtlieqamkgtsvaeifehfgesvfreketealkklslmyh
    qvvvstgggavirpinwkymhkgisiwldvplealahriaavgtgsrpllhddesgdtyt
    aalnrlstiwdargeaytkasarvslenitlklgyrsvsdltpaeiaieafeqvqsylek
    edgmarpdgl
    

    Sequence, based on observed residues (ATOM records):
    >3nwjB (B:)
    qqilkkkaeevkpylngrsmylvgmmgsgkttvgkimarslgytffdcdtlieqamkgts
    vaeifehfgesvfreketealkklslmyhqvvvstgggavirpinwkymhkgisiwldvp
    lealahritytaalnrlstiwdargeaytkasarvslenitlklgyrsvsdltpaeiaie
    afeqvqsyleke