PDB entry 3nwi

View 3nwi on RCSB PDB site
Description: the soluble domain structure of the zntb zn2+ efflux system
Deposited on 2010-07-09, released 2011-03-23
The last revision was dated 2016-02-17, with a file datestamp of 2016-02-12.
Experiment type: XRAY
Resolution: 3.13 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc transport protein zntB
    Species: Salmonella enterica [TaxId:90371]
    Gene: zntB, STM1656
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EYX5 (1-End)
      • expression tag (0)
  • Chain 'B':
    Compound: Zinc transport protein zntB
    Species: Salmonella enterica [TaxId:90371]
    Gene: zntB, STM1656
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EYX5 (1-End)
      • expression tag (0)
  • Chain 'C':
    Compound: Zinc transport protein zntB
    Species: Salmonella enterica [TaxId:90371]
    Gene: zntB, STM1656
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EYX5 (1-262)
      • expression tag (0)
  • Chain 'D':
    Compound: Zinc transport protein zntB
    Species: Salmonella enterica [TaxId:90371]
    Gene: zntB, STM1656
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EYX5 (1-262)
      • expression tag (0)
  • Chain 'E':
    Compound: Zinc transport protein zntB
    Species: Salmonella enterica [TaxId:90371]
    Gene: zntB, STM1656
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EYX5 (1-End)
      • expression tag (0)
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nwiA (A:)
    hmeaikgsdvnvpdavfawlldgrggvkpledndvidsqhpcwlhlnythpdsarwlast
    pllpnnvrdalagessrprvsrmgegtlitlrcingstderpdqlvamrlymderfivst
    rqrkvlalddvvsdlqegtgpvdcggwlvdvcdaltdhasefieelhdkiidlednlldq
    qipprgflallrkqlivmrrymapqrdvyarlaserlpwmsddhrrrmqdiadrlgrgld
    eidaciartgimadeiaqvmqes
    

    Sequence, based on observed residues (ATOM records):
    >3nwiA (A:)
    hmeaikgsdvnvpdavfawlldgrggvkpledndvidsqhpcwlhlnythpdsarwlast
    pllpnnvrdalagessrprvsrmgegtlitlrcilvamrlymderfivstrqrkvlaldd
    vvsdlqegtgpvdcggwlvdvcdaltdhasefieelhdkiidlednqipprgflallrkq
    livmrrymapqrdvyarlaserlpwmsddhrrrmqdiadrlgrgldeidaciartgimad
    eiaqv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nwiB (B:)
    hmeaikgsdvnvpdavfawlldgrggvkpledndvidsqhpcwlhlnythpdsarwlast
    pllpnnvrdalagessrprvsrmgegtlitlrcingstderpdqlvamrlymderfivst
    rqrkvlalddvvsdlqegtgpvdcggwlvdvcdaltdhasefieelhdkiidlednlldq
    qipprgflallrkqlivmrrymapqrdvyarlaserlpwmsddhrrrmqdiadrlgrgld
    eidaciartgimadeiaqvmqes
    

    Sequence, based on observed residues (ATOM records):
    >3nwiB (B:)
    hmeaikgsdvnvpdavfawlldgrggvkpledndvidsqhpcwlhlnythpdsarwlast
    pllpnnvrdalagessrprvsrmgegtlitlrcilvamrlymderfivstrqrkvlaldd
    vvsdlqegtgpvdcggwlvdvcdaltdhasefieelhdkiidlednqipprgflallrkq
    livmrrymapqrdvyarlaserlpwmsddhrrrmqdiadrlgrgldeidaciartgimad
    eiaqvmq
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nwiC (C:)
    hmeaikgsdvnvpdavfawlldgrggvkpledndvidsqhpcwlhlnythpdsarwlast
    pllpnnvrdalagessrprvsrmgegtlitlrcingstderpdqlvamrlymderfivst
    rqrkvlalddvvsdlqegtgpvdcggwlvdvcdaltdhasefieelhdkiidlednlldq
    qipprgflallrkqlivmrrymapqrdvyarlaserlpwmsddhrrrmqdiadrlgrgld
    eidaciartgimadeiaqvmqes
    

    Sequence, based on observed residues (ATOM records):
    >3nwiC (C:)
    hmeaikgsdvnvpdavfawlldgrggvkpledndvidsqhpcwlhlnythpdsarwlast
    pllpnnvrdalagessrprvsrmgegtlitlrcilvamrlymderfivstrqrkvlaldd
    vvsdlqegtgpvdcggwlvdvcdaltdhasefieelhdkiidlednqipprgflallrkq
    livmrrymapqrdvyarlaserlpwmsddhrrrmqdiadrlgrgldeidaciartgimad
    eiaqvmqes
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nwiD (D:)
    hmeaikgsdvnvpdavfawlldgrggvkpledndvidsqhpcwlhlnythpdsarwlast
    pllpnnvrdalagessrprvsrmgegtlitlrcingstderpdqlvamrlymderfivst
    rqrkvlalddvvsdlqegtgpvdcggwlvdvcdaltdhasefieelhdkiidlednlldq
    qipprgflallrkqlivmrrymapqrdvyarlaserlpwmsddhrrrmqdiadrlgrgld
    eidaciartgimadeiaqvmqes
    

    Sequence, based on observed residues (ATOM records):
    >3nwiD (D:)
    hmeaikgsdvnvpdavfawlldgrggvkpledndvidsqhpcwlhlnythpdsarwlast
    pllpnnvrdalagessrprvsrmgegtlitlrcilvamrlymderfivstrqrkvlaldd
    vvsdlqegtgpvdcggwlvdvcdaltdhasefieelhdkiidlednqipprgflallrkq
    livmrrymapqrdvyarlaserlpwmsddhrrrmqdiadrlgrgldeidaciartgimad
    eiaqvmqes
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3nwiE (E:)
    hmeaikgsdvnvpdavfawlldgrggvkpledndvidsqhpcwlhlnythpdsarwlast
    pllpnnvrdalagessrprvsrmgegtlitlrcingstderpdqlvamrlymderfivst
    rqrkvlalddvvsdlqegtgpvdcggwlvdvcdaltdhasefieelhdkiidlednlldq
    qipprgflallrkqlivmrrymapqrdvyarlaserlpwmsddhrrrmqdiadrlgrgld
    eidaciartgimadeiaqvmqes
    

    Sequence, based on observed residues (ATOM records):
    >3nwiE (E:)
    hmeaikgsdvnvpdavfawlldgrggvkpledndvidsqhpcwlhlnythpdsarwlast
    pllpnnvrdalagessrprvsrmgegtlitlrcilvamrlymderfivstrqrkvlaldd
    vvsdlqegtgpvdcggwlvdvcdaltdhasefieelhdkiidlednqipprgflallrkq
    livmrrymapqrdvyarlaserlpwmsddhrrrmqdiadrlgrgldeidaciartgimad
    eiaqvmqe