PDB entry 3nwg

View 3nwg on RCSB PDB site
Description: The crystal structure of a microcomparments protein from Desulfitobacterium hafniense DCB
Class: structural protein
Keywords: Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, BMC domain, STRUCTURAL PROTEIN
Deposited on 2010-07-09, released 2010-09-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Microcompartments protein
    Species: Desulfitobacterium hafniense [TaxId:272564]
    Gene: Dhaf_0360
    Database cross-references and differences (RAF-indexed):
    • Uniprot B8G1Q4 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d3nwga1, d3nwga2, d3nwga3
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nwgA (A:)
    amesiglvevnsiargieaadamlkaaqvdlleakpvcpgkyivlicgdvaavqssvtag
    ktmaahsvlddfilpnvhpqvltaisaatpltlikalgiietfsiaslivaadtaaktgq
    vdlveirigmgiggksfvtltgdvasvessvaagvmlasergmlvdkvvipsphdhlkrc
    lc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nwgA (A:)
    amesiglvevnsiargieaadamlkaaqvdlleakpvcpgkyivlicgdvaavqssvtag
    ktmaahsvlddfilpnvhpqvltaisaatpltlikalgiietfsiaslivaadtaaktgq
    vdlveirigmgiggksfvtltgdvasvessvaagvmlasergmlvdkvvipsphdhlkrc