PDB entry 3nwf

View 3nwf on RCSB PDB site
Description: Glycoprotein B from Herpes simplex virus type 1, low-pH
Class: viral protein
Keywords: Coiled-Coil, ENVELOPE GLYCOPROTEIN, MEMBRANE FUSION, VIRAL PROTEIN, Glycoprotein B, Herpesvirus 1, HSV-1, Membrane
Deposited on 2010-07-09, released 2010-12-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.199
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope glycoprotein B
    Species: Human herpesvirus 1 [TaxId:10306]
    Gene: GB, UL27
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06437
      • see remark 999 (285)
      • see remark 999 (415)
    Domains in SCOPe 2.07: d3nwfa_
  • Chain 'B':
    Compound: Envelope glycoprotein B
    Species: Human herpesvirus 1 [TaxId:10306]
    Gene: GB, UL27
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06437
      • see remark 999 (285)
      • see remark 999 (415)
    Domains in SCOPe 2.07: d3nwfb_
  • Chain 'C':
    Compound: Envelope glycoprotein B
    Species: Human herpesvirus 1 [TaxId:10306]
    Gene: GB, UL27
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06437
      • see remark 999 (285)
      • see remark 999 (415)
    Domains in SCOPe 2.07: d3nwfc_
  • Chain 'D':
    Compound: Envelope glycoprotein B
    Species: Human herpesvirus 1 [TaxId:10306]
    Gene: GB, UL27
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06437
      • see remark 999 (285)
      • see remark 999 (415)
    Domains in SCOPe 2.07: d3nwfd_
  • Heterogens: NAG, MRY, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nwfA (A:)
    dpaaptspgtpgvaaatqaanggpatpappalgaaptgdpkpkknkkpknptpprpagdn
    atvaaghatlrehlrdikaentdanfyvcppptgatvvqfeqprrcptrpegqnytegia
    vvfkeniapykfkatmyykdvtvsqvwfghrysqfmgifedrapvpfeevidkinakgvc
    rstakyvrnnlettafhrddhetdmelkpanaatrtsrgwhttdlkynpsrveafhrygt
    tvnciveevdarsvypydefvlatgdfvymspfygyregshtehtsyaadrfkqvdgfya
    rdlttkaratapttrnllttpkftvawdwvpkrpsvctmtkwqevdemlrseyggsfrfs
    sdaisttfttnlteyplsrvdlgdcigkdardamdrifarrynathikvgqpqyylangg
    fliayqpllsntlaelyvrehlreqsrkppnptppppgasanasverikttssiefarlq
    ftynhiqrhvndmlgrvaiawcelqnheltlwnearklnpnaiasvtvgrrvsarmlgdv
    mavstcvpvaadnvivqnsmrissrpgacysrplvsfryedqgplvegqlgennelrltr
    daiepctvghrryftfgggyvyfeeyayshqlsradittvstfidlnitmledhefvple
    vytrheikdsglldytevqrrnqlhdlrfadidtvihadanaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nwfA (A:)
    dikaentdanfyvcppptgatvvqfeqprrcptrpegqnytegiavvfkeniapykfkat
    myykdvtvsqvwfghrysqfmgifedrapvpfeevidkinakgvcrstakyvrnnletta
    fhrddhetdmelkpanaatrtsrgwhttdlkynpsrvehrygttvnciveevdarsvypy
    defvlatgdfvymspfygyregshtehtsyaadrfkqvdgfyardlttkaratapttrnl
    lttpkftvawdwvpkrpsvctmtkwqevdemlrseyggsfrfssdaisttfttnlteypl
    srvdlgdcigkdardamdrifarrynathikvgqpqyylanggfliayqpllsntlaely
    vrehlreqsrkpverikttssiefarlqftynhiqrhvndmlgrvaiawcelqnheltlw
    nearklnpnaiasvtvgrrvsarmlgdvmavstcvpvaadnvivqnsmrissrpgacysr
    plvsfryedqgplvegqlgennelrltrdaiepctvghrryftfgggyvyfeeyayshql
    sradittvstfidlnitmledhefvplevytrheikdsglldytevqrrnqlhdlrfadi
    dtvih
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nwfB (B:)
    dpaaptspgtpgvaaatqaanggpatpappalgaaptgdpkpkknkkpknptpprpagdn
    atvaaghatlrehlrdikaentdanfyvcppptgatvvqfeqprrcptrpegqnytegia
    vvfkeniapykfkatmyykdvtvsqvwfghrysqfmgifedrapvpfeevidkinakgvc
    rstakyvrnnlettafhrddhetdmelkpanaatrtsrgwhttdlkynpsrveafhrygt
    tvnciveevdarsvypydefvlatgdfvymspfygyregshtehtsyaadrfkqvdgfya
    rdlttkaratapttrnllttpkftvawdwvpkrpsvctmtkwqevdemlrseyggsfrfs
    sdaisttfttnlteyplsrvdlgdcigkdardamdrifarrynathikvgqpqyylangg
    fliayqpllsntlaelyvrehlreqsrkppnptppppgasanasverikttssiefarlq
    ftynhiqrhvndmlgrvaiawcelqnheltlwnearklnpnaiasvtvgrrvsarmlgdv
    mavstcvpvaadnvivqnsmrissrpgacysrplvsfryedqgplvegqlgennelrltr
    daiepctvghrryftfgggyvyfeeyayshqlsradittvstfidlnitmledhefvple
    vytrheikdsglldytevqrrnqlhdlrfadidtvihadanaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nwfB (B:)
    anfyvcppptgatvvqfeqprrcptrpegqnytegiavvfkeniapykfkatmyykdvtv
    sqvwfghrysqfmgifedrapvpfeevidkinakgvcrstakyvrnnlettafhrddhet
    dmelkpanaatrtsrgwhttdlkynpsrvhrygttvnciveevdarsvypydefvlatgd
    fvymspfygyregshtehtsyaadrfkqvdgfyardlttkaratapttrnllttpkftva
    wdwvpkrpsvctmtkwqevdemlrseyggsfrfssdaisttfttnlteyplsrvdlgdci
    gkdardamdrifarrynathikvgqpqyylanggfliayqpllsntlaelyvrehlreqs
    rkpverikttssiefarlqftynhiqrhvndmlgrvaiawcelqnheltlwnearklnpn
    aiasvtvgrrvsarmlgdvmavstcvpvaadnvivqnsmrissrpgacysrplvsfryed
    qgplvegqlgennelrltrdaiepctvghrryftfgggyvyfeeyayshqlsradittvs
    tfidlnitmledhefvplevytrheikdsglldytevqrrnqlhdlrfadidtvih
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nwfC (C:)
    dpaaptspgtpgvaaatqaanggpatpappalgaaptgdpkpkknkkpknptpprpagdn
    atvaaghatlrehlrdikaentdanfyvcppptgatvvqfeqprrcptrpegqnytegia
    vvfkeniapykfkatmyykdvtvsqvwfghrysqfmgifedrapvpfeevidkinakgvc
    rstakyvrnnlettafhrddhetdmelkpanaatrtsrgwhttdlkynpsrveafhrygt
    tvnciveevdarsvypydefvlatgdfvymspfygyregshtehtsyaadrfkqvdgfya
    rdlttkaratapttrnllttpkftvawdwvpkrpsvctmtkwqevdemlrseyggsfrfs
    sdaisttfttnlteyplsrvdlgdcigkdardamdrifarrynathikvgqpqyylangg
    fliayqpllsntlaelyvrehlreqsrkppnptppppgasanasverikttssiefarlq
    ftynhiqrhvndmlgrvaiawcelqnheltlwnearklnpnaiasvtvgrrvsarmlgdv
    mavstcvpvaadnvivqnsmrissrpgacysrplvsfryedqgplvegqlgennelrltr
    daiepctvghrryftfgggyvyfeeyayshqlsradittvstfidlnitmledhefvple
    vytrheikdsglldytevqrrnqlhdlrfadidtvihadanaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nwfC (C:)
    rdikaentdanfyvcppptgatvvqfeqprrcptrpegqnytegiavvfkeniapykfka
    tmyykdvtvsqvwfghrysqfmgifedrapvpfeevidkinakgvcrstakyvrnnlett
    afhrddhetdmelkpanaatrtsrgwhttdlkynpsrveygttvnciveevdarsvypyd
    efvlatgdfvymspfygyregshtehtsyaadrfkqvdgfyardlttkaratapttrnll
    ttpkftvawdwvpkrpsvctmtkwqevdemlrseyggsfrfssdaisttfttnlteypls
    rvdlgdcigkdardamdrifarrynathikvgqpqyylanggfliayqpllsntlaelyv
    rehlreqsrkverikttssiefarlqftynhiqrhvndmlgrvaiawcelqnheltlwne
    arklnpnaiasvtvgrrvsarmlgdvmavstcvpvaadnvivqnsmrissrpgacysrpl
    vsfryedqgplvegqlgennelrltrdaiepctvghrryftfgggyvyfeeyayshqlsr
    adittvstfidlnitmledhefvplevytrheikdsglldytevqrrnqlhdlrfadidt
    vih
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nwfD (D:)
    dpaaptspgtpgvaaatqaanggpatpappalgaaptgdpkpkknkkpknptpprpagdn
    atvaaghatlrehlrdikaentdanfyvcppptgatvvqfeqprrcptrpegqnytegia
    vvfkeniapykfkatmyykdvtvsqvwfghrysqfmgifedrapvpfeevidkinakgvc
    rstakyvrnnlettafhrddhetdmelkpanaatrtsrgwhttdlkynpsrveafhrygt
    tvnciveevdarsvypydefvlatgdfvymspfygyregshtehtsyaadrfkqvdgfya
    rdlttkaratapttrnllttpkftvawdwvpkrpsvctmtkwqevdemlrseyggsfrfs
    sdaisttfttnlteyplsrvdlgdcigkdardamdrifarrynathikvgqpqyylangg
    fliayqpllsntlaelyvrehlreqsrkppnptppppgasanasverikttssiefarlq
    ftynhiqrhvndmlgrvaiawcelqnheltlwnearklnpnaiasvtvgrrvsarmlgdv
    mavstcvpvaadnvivqnsmrissrpgacysrplvsfryedqgplvegqlgennelrltr
    daiepctvghrryftfgggyvyfeeyayshqlsradittvstfidlnitmledhefvple
    vytrheikdsglldytevqrrnqlhdlrfadidtvihadanaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nwfD (D:)
    rdikaentdanfyvcppptgatvvqfeqprrcptrpegqnytegiavvfkeniapykfka
    tmyykdvtvsqvwfghrysqfmgifedrapvpfeevidkinakgvcrstakyvrnnlett
    afhrddhetdmelkpanaatrtsrgwhttdlkynpsrvhrygttvnciveevdarsvypy
    defvlatgdfvymspfygyregshtehtsyaadrfkqvdgfyardlttkaratapttrnl
    lttpkftvawdwvpkrpsvctmtkwqevdemlrseyggsfrfssdaisttfttnlteypl
    srvdlgdcigkdardamdrifarrynathikvgqpqyylanggfliayqpllsntlaely
    vrehlreqsrkppverikttssiefarlqftynhiqrhvndmlgrvaiawcelqnheltl
    wnearklnpnaiasvtvgrrvsarmlgdvmavstcvpvaadnvivqnsmrissrpgacys
    rplvsfryedqgplvegqlgennelrltrdaiepctvghrryftfgggyvyfeeyayshq
    lsradittvstfidlnitmledhefvplevytrheikdsglldytevqrrnqlhdlrfad
    idtvi