PDB entry 3nwd

View 3nwd on RCSB PDB site
Description: Glycoprotein B from Herpes simplex virus type 1, Y179S mutant, low-pH
Class: viral protein
Keywords: Coiled-Coil, ENVELOPE GLYCOPROTEIN, MEMBRANE FUSION, VIRAL PROTEIN, Glycoprotein B, Herpesvirus 1, HSV-1, Membrane
Deposited on 2010-07-09, released 2010-12-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: XRAY
Resolution: 2.88 Å
R-factor: 0.24
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope glycoprotein B
    Species: Human herpesvirus 1 [TaxId:10306]
    Gene: GB, UL27
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06437
      • engineered mutation (151)
      • see remark 999 (285)
      • see remark 999 (415)
    Domains in SCOPe 2.07: d3nwda_
  • Chain 'B':
    Compound: Envelope glycoprotein B
    Species: Human herpesvirus 1 [TaxId:10306]
    Gene: GB, UL27
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06437
      • engineered mutation (151)
      • see remark 999 (285)
      • see remark 999 (415)
    Domains in SCOPe 2.07: d3nwdb_
  • Chain 'C':
    Compound: Envelope glycoprotein B
    Species: Human herpesvirus 1 [TaxId:10306]
    Gene: GB, UL27
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06437
      • engineered mutation (151)
      • see remark 999 (285)
      • see remark 999 (415)
    Domains in SCOPe 2.07: d3nwdc_
  • Chain 'D':
    Compound: Envelope glycoprotein B
    Species: Human herpesvirus 1 [TaxId:10306]
    Gene: GB, UL27
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06437
      • engineered mutation (151)
      • see remark 999 (285)
      • see remark 999 (415)
    Domains in SCOPe 2.07: d3nwdd_
  • Heterogens: NAG, CL, MRY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nwdA (A:)
    dpaaptspgtpgvaaatqaanggpatpappalgaaptgdpkpkknkkpknptpprpagdn
    atvaaghatlrehlrdikaentdanfyvcppptgatvvqfeqprrcptrpegqnytegia
    vvfkeniapykfkatmyykdvtvsqvwfghrssqfmgifedrapvpfeevidkinakgvc
    rstakyvrnnlettafhrddhetdmelkpanaatrtsrgwhttdlkynpsrveafhrygt
    tvnciveevdarsvypydefvlatgdfvymspfygyregshtehtsyaadrfkqvdgfya
    rdlttkaratapttrnllttpkftvawdwvpkrpsvctmtkwqevdemlrseyggsfrfs
    sdaisttfttnlteyplsrvdlgdcigkdardamdrifarrynathikvgqpqyylangg
    fliayqpllsntlaelyvrehlreqsrkppnptppppgasanasverikttssiefarlq
    ftynhiqrhvndmlgrvaiawcelqnheltlwnearklnpnaiasvtvgrrvsarmlgdv
    mavstcvpvaadnvivqnsmrissrpgacysrplvsfryedqgplvegqlgennelrltr
    daiepctvghrryftfgggyvyfeeyayshqlsradittvstfidlnitmledhefvple
    vytrheikdsglldytevqrrnqlhdlrfadidtvihadanaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nwdA (A:)
    ikaentdanfyvcppptgatvvqfeqprrcptrpegqnytegiavvfkeniapykfkatm
    yykdvtvsqvwfghrssqfmgifedrapvpfeevidkinakgvcrstakyvrnnlettaf
    hrddhetdmelkpanaatrtsrgwhttdlkynpsrveafhrygttvnciveevdarsvyp
    ydefvlatgdfvymspfygyregshtehtsyaadrfkqvdgfyardlttkaratapttrn
    llttpkftvawdwvpkrpsvctmtkwqevdemlrseyggsfrfssdaisttfttnlteyp
    lsrvdlgdcigkdardamdrifarrynathikvgqpqyylanggfliayqpllsntlael
    yvrehlreqsrkppverikttssiefarlqftynhiqrhvndmlgrvaiawcelqnhelt
    lwnearklnpnaiasvtvgrrvsarmlgdvmavstcvpvaadnvivqnsmrissrpgacy
    srplvsfryedqgplvegqlgennelrltrdaiepctvghrryftfgggyvyfeeyaysh
    qlsradittvstfidlnitmledhefvplevytrheikdsglldytevqrrnqlhdlrfa
    didtvi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nwdB (B:)
    dpaaptspgtpgvaaatqaanggpatpappalgaaptgdpkpkknkkpknptpprpagdn
    atvaaghatlrehlrdikaentdanfyvcppptgatvvqfeqprrcptrpegqnytegia
    vvfkeniapykfkatmyykdvtvsqvwfghrssqfmgifedrapvpfeevidkinakgvc
    rstakyvrnnlettafhrddhetdmelkpanaatrtsrgwhttdlkynpsrveafhrygt
    tvnciveevdarsvypydefvlatgdfvymspfygyregshtehtsyaadrfkqvdgfya
    rdlttkaratapttrnllttpkftvawdwvpkrpsvctmtkwqevdemlrseyggsfrfs
    sdaisttfttnlteyplsrvdlgdcigkdardamdrifarrynathikvgqpqyylangg
    fliayqpllsntlaelyvrehlreqsrkppnptppppgasanasverikttssiefarlq
    ftynhiqrhvndmlgrvaiawcelqnheltlwnearklnpnaiasvtvgrrvsarmlgdv
    mavstcvpvaadnvivqnsmrissrpgacysrplvsfryedqgplvegqlgennelrltr
    daiepctvghrryftfgggyvyfeeyayshqlsradittvstfidlnitmledhefvple
    vytrheikdsglldytevqrrnqlhdlrfadidtvihadanaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nwdB (B:)
    kaentdanfyvcppptgatvvqfeqprrcptrpegqnytegiavvfkeniapykfkatmy
    ykdvtvsqvwfghrssqfmgifedrapvpfeevidkinakgvcrstakyvrnnlettafh
    rddhetdmelkpanaatrtsrgwhttdlkynpsrverygttvnciveevdarsvypydef
    vlatgdfvymspfygyregshtehtsyaadrfkqvdgfyardlttkaratapttrnlltt
    pkftvawdwvpkrpsvctmtkwqevdemlrseyggsfrfssdaisttfttnlteyplsrv
    dlgdcigkdardamdrifarrynathikvgqpqyylanggfliayqpllsntlahlreqs
    rksverikttssiefarlqftynhiqrhvndmlgrvaiawcelqnheltlwnearklnpn
    aiasvtvgrrvsarmlgdvmavstcvpvaadnvivqnsmrissrpgacysrplvsfryed
    qgplvegqlgennelrltrdaiepctvghrryftfgggyvyfeeyayshqlsradittvs
    tfidlnitmledhefvplevytrheikdsglldytevqrrnqlhdlrfadidtviha
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nwdC (C:)
    dpaaptspgtpgvaaatqaanggpatpappalgaaptgdpkpkknkkpknptpprpagdn
    atvaaghatlrehlrdikaentdanfyvcppptgatvvqfeqprrcptrpegqnytegia
    vvfkeniapykfkatmyykdvtvsqvwfghrssqfmgifedrapvpfeevidkinakgvc
    rstakyvrnnlettafhrddhetdmelkpanaatrtsrgwhttdlkynpsrveafhrygt
    tvnciveevdarsvypydefvlatgdfvymspfygyregshtehtsyaadrfkqvdgfya
    rdlttkaratapttrnllttpkftvawdwvpkrpsvctmtkwqevdemlrseyggsfrfs
    sdaisttfttnlteyplsrvdlgdcigkdardamdrifarrynathikvgqpqyylangg
    fliayqpllsntlaelyvrehlreqsrkppnptppppgasanasverikttssiefarlq
    ftynhiqrhvndmlgrvaiawcelqnheltlwnearklnpnaiasvtvgrrvsarmlgdv
    mavstcvpvaadnvivqnsmrissrpgacysrplvsfryedqgplvegqlgennelrltr
    daiepctvghrryftfgggyvyfeeyayshqlsradittvstfidlnitmledhefvple
    vytrheikdsglldytevqrrnqlhdlrfadidtvihadanaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nwdC (C:)
    ikaentdanfyvcppptgatvvqfeqprrcptrpegqnytegiavvfkeniapykfkatm
    yykdvtvsqvwfghrssqfmgifedrapvpfeevidkinakgvcrstakyvrnnlettaf
    hrddhetdmelkpanaatrtsrgwhttdlkynpsrvhrygttvnciveevdarsvypyde
    fvlatgdfvymspfygyregshtehtsyaadrfkqvdgfyardlttkaratapttrnllt
    tpkftvawdwvpkrpsvctmtkwqevdemlrseyggsfrfssdaisttfttnlteyplsr
    vdlgdcigkdardamdrifarrynathikvgqpqyylanggfliayqpllsntlaelyvr
    ehlreqsrkverikttssiefarlqftynhiqrhvndmlgrvaiawcelqnheltlwnea
    rklnpnaiasvtvgrrvsarmlgdvmavstcvpvaadnvivqnsmrissrpgacysrplv
    sfryedqgplvegqlgennelrltrdaiepctvghrryftfgggyvyfeeyayshqlsra
    dittvstfidlnitmledhefvplevytrheikdsglldytevqrrnqlhdlrfadidtv
    i
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nwdD (D:)
    dpaaptspgtpgvaaatqaanggpatpappalgaaptgdpkpkknkkpknptpprpagdn
    atvaaghatlrehlrdikaentdanfyvcppptgatvvqfeqprrcptrpegqnytegia
    vvfkeniapykfkatmyykdvtvsqvwfghrssqfmgifedrapvpfeevidkinakgvc
    rstakyvrnnlettafhrddhetdmelkpanaatrtsrgwhttdlkynpsrveafhrygt
    tvnciveevdarsvypydefvlatgdfvymspfygyregshtehtsyaadrfkqvdgfya
    rdlttkaratapttrnllttpkftvawdwvpkrpsvctmtkwqevdemlrseyggsfrfs
    sdaisttfttnlteyplsrvdlgdcigkdardamdrifarrynathikvgqpqyylangg
    fliayqpllsntlaelyvrehlreqsrkppnptppppgasanasverikttssiefarlq
    ftynhiqrhvndmlgrvaiawcelqnheltlwnearklnpnaiasvtvgrrvsarmlgdv
    mavstcvpvaadnvivqnsmrissrpgacysrplvsfryedqgplvegqlgennelrltr
    daiepctvghrryftfgggyvyfeeyayshqlsradittvstfidlnitmledhefvple
    vytrheikdsglldytevqrrnqlhdlrfadidtvihadanaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nwdD (D:)
    ikaentdanfyvcppptgatvvqfeqprrcptrpegqnytegiavvfkeniapykfkatm
    yykdvtvsqvwfghrssqfmgifedrapvpfeevidkinakgvcrstakyvrnnlettaf
    hrddhetdmelkpanaatrtsrgwhttdlkynpsrvearygttvnciveevdarsvypyd
    efvlatgdfvymspfygyregshtehtsyaadrfkqvdgfyardlttkaratapttrnll
    ttpkftvawdwvpkrpsvctmtkwqevdemlrseyggsfrfssdaisttfttnlteypls
    rvdlgdcigkdardamdrifarrynathikvgqpqyylanggfliayqpllsntlaelyv
    rehlreqsrkppverikttssiefarlqftynhiqrhvndmlgrvaiawcelqnheltlw
    nearklnpnaiasvtvgrrvsarmlgdvmavstcvpvaadnvivqnsmrissrpgacysr
    plvsfryedqgplvegqlgennelrltrdaiepctvghrryftfgggyvyfeeyayshql
    sradittvstfidlnitmledhefvplevytrheikdsglldytevqrrnqlhdlrfadi
    dtviha