PDB entry 3nwc

View 3nwc on RCSB PDB site
Description: Crystal Structure of the Pyrococcus furiosus SMC Protein Hinge Domain
Deposited on 2010-07-09, released 2010-10-20
The last revision was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.198
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SMC protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: SMC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q877I1 (1-180)
      • expression tag (0)
      • expression tag (181)
  • Chain 'B':
    Compound: SMC protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: SMC
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nwcA (A:)
    melessereliaaeaqrevrgnraaeelkrsgiggiygtlaelikvkdeayalaievalg
    nradnvvvedelvaekaikylkehklgrltflplnkikpkhvdssvglpavdvieydqki
    enavkfalgdtvivnsmeearphigkvrmvtiegelyersgaitgghfrarglavdttkl
    rlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nwcA (A:)
    melessereliaaeaqrevrgnraaeelkrsgiggiygtlaelikvkdeayalaievalg
    nradnvvvedelvaekaikylkehklgrltflplnkikpkhvdssvglpavdvieydqki
    enavkfalgdtvivnsmeearphigkvrmvtiegelyersgaitgghfrarglavdttkl
    rl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nwcB (B:)
    melessereliaaeaqrevrgnraaeelkrsgiggiygtlaelikvkdeayalaievalg
    nradnvvvedelvaekaikylkehklgrltflplnkikpkhvdssvglpavdvieydqki
    enavkfalgdtvivnsmeearphigkvrmvtiegelyersgaitgghfrarglavdttkl
    rlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nwcB (B:)
    elessereliaaeaqrevrgnraaeelkrsgiggiygtlaelikvkdeayalaievalgn
    radnvvvedelvaekaikylkehklgrltflplnkikpkhvdssvglpavdvieydqkie
    navkfalgdtvivnsmeearphigkvrmvtiegelyersgaitgghfrarglavd