PDB entry 3nwa

View 3nwa on RCSB PDB site
Description: Glycoprotein B from Herpes simplex virus type 1, W174R mutant, low-pH
Class: viral protein
Keywords: Coiled-Coil, ENVELOPE GLYCOPROTEIN, MEMBRANE FUSION, VIRAL PROTEIN, Glycoprotein B, Herpesvirus 1, HSV-1, Membrane
Deposited on 2010-07-09, released 2010-12-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.176
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope glycoprotein B
    Species: Human herpesvirus 1 [TaxId:10306]
    Gene: GB, UL27
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06437
      • engineered mutation (146)
      • see remark 999 (285)
      • see remark 999 (415)
    Domains in SCOPe 2.07: d3nwaa_
  • Chain 'B':
    Compound: Envelope glycoprotein B
    Species: Human herpesvirus 1 [TaxId:10306]
    Gene: GB, UL27
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06437
      • engineered mutation (146)
      • see remark 999 (285)
      • see remark 999 (415)
    Domains in SCOPe 2.07: d3nwab_
  • Chain 'C':
    Compound: Envelope glycoprotein B
    Species: Human herpesvirus 1 [TaxId:10306]
    Gene: GB, UL27
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06437
      • engineered mutation (146)
      • see remark 999 (285)
      • see remark 999 (415)
    Domains in SCOPe 2.07: d3nwac_
  • Chain 'D':
    Compound: Envelope glycoprotein B
    Species: Human herpesvirus 1 [TaxId:10306]
    Gene: GB, UL27
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06437
      • engineered mutation (146)
      • see remark 999 (285)
      • see remark 999 (415)
    Domains in SCOPe 2.07: d3nwad_
  • Heterogens: NAG, MRY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nwaA (A:)
    dpaaptspgtpgvaaatqaanggpatpappalgaaptgdpkpkknkkpknptpprpagdn
    atvaaghatlrehlrdikaentdanfyvcppptgatvvqfeqprrcptrpegqnytegia
    vvfkeniapykfkatmyykdvtvsqvrfghrysqfmgifedrapvpfeevidkinakgvc
    rstakyvrnnlettafhrddhetdmelkpanaatrtsrgwhttdlkynpsrveafhrygt
    tvnciveevdarsvypydefvlatgdfvymspfygyregshtehtsyaadrfkqvdgfya
    rdlttkaratapttrnllttpkftvawdwvpkrpsvctmtkwqevdemlrseyggsfrfs
    sdaisttfttnlteyplsrvdlgdcigkdardamdrifarrynathikvgqpqyylangg
    fliayqpllsntlaelyvrehlreqsrkppnptppppgasanasverikttssiefarlq
    ftynhiqrhvndmlgrvaiawcelqnheltlwnearklnpnaiasvtvgrrvsarmlgdv
    mavstcvpvaadnvivqnsmrissrpgacysrplvsfryedqgplvegqlgennelrltr
    daiepctvghrryftfgggyvyfeeyayshqlsradittvstfidlnitmledhefvple
    vytrheikdsglldytevqrrnqlhdlrfadidtvihadanaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nwaA (A:)
    dikaentdanfyvcppptgatvvqfeqprrcptrpegqnytegiavvfkeniapykfkat
    myykdvtvsqvrfghrysqfmgifedrapvpfeevidkinakgvcrstakyvrnnletta
    fhrddhetdmelkpanaatrtsrgwhttdlkynpsrveafhrygttvnciveevdarsvy
    pydefvlatgdfvymspfygyregshtehtsyaadrfkqvdgfyardlttkaratapttr
    nllttpkftvawdwvpkrpsvctmtkwqevdemlrseyggsfrfssdaisttfttnltey
    plsrvdlgdcigkdardamdrifarrynathikvgqpqyylanggfliayqpllsntlae
    lyvrehlreqsrkppverikttssiefarlqftynhiqrhvndmlgrvaiawcelqnhel
    tlwnearklnpnaiasvtvgrrvsarmlgdvmavstcvpvaadnvivqnsmrissrpgac
    ysrplvsfryedqgplvegqlgennelrltrdaiepctvghrryftfgggyvyfeeyays
    hqlsradittvstfidlnitmledhefvplevytrheikdsglldytevqrrnqlhdlrf
    adidtvih
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nwaB (B:)
    dpaaptspgtpgvaaatqaanggpatpappalgaaptgdpkpkknkkpknptpprpagdn
    atvaaghatlrehlrdikaentdanfyvcppptgatvvqfeqprrcptrpegqnytegia
    vvfkeniapykfkatmyykdvtvsqvrfghrysqfmgifedrapvpfeevidkinakgvc
    rstakyvrnnlettafhrddhetdmelkpanaatrtsrgwhttdlkynpsrveafhrygt
    tvnciveevdarsvypydefvlatgdfvymspfygyregshtehtsyaadrfkqvdgfya
    rdlttkaratapttrnllttpkftvawdwvpkrpsvctmtkwqevdemlrseyggsfrfs
    sdaisttfttnlteyplsrvdlgdcigkdardamdrifarrynathikvgqpqyylangg
    fliayqpllsntlaelyvrehlreqsrkppnptppppgasanasverikttssiefarlq
    ftynhiqrhvndmlgrvaiawcelqnheltlwnearklnpnaiasvtvgrrvsarmlgdv
    mavstcvpvaadnvivqnsmrissrpgacysrplvsfryedqgplvegqlgennelrltr
    daiepctvghrryftfgggyvyfeeyayshqlsradittvstfidlnitmledhefvple
    vytrheikdsglldytevqrrnqlhdlrfadidtvihadanaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nwaB (B:)
    dikaentdanfyvcppptgatvvqfeqprrcptrpegqnytegiavvfkeniapykfkat
    myykdvtvsqvrfghrysqfmgifedrapvpfeevidkinakgvcrstakyvrnnletta
    fhrddhetdmelkpanaatrtsrgwhttdlkynpsrveafhrygttvnciveevdarsvy
    pydefvlatgdfvymspfygyregshtehtsyaadrfkqvdgfyardlttkaratapttr
    nllttpkftvawdwvpkrpsvctmtkwqevdemlrseyggsfrfssdaisttfttnltey
    plsrvdlgdcigkdardamdrifarrynathikvgqpqyylanggfliayqpllsntlae
    lyvrehlreqsrkpverikttssiefarlqftynhiqrhvndmlgrvaiawcelqnhelt
    lwnearklnpnaiasvtvgrrvsarmlgdvmavstcvpvaadnvivqnsmrissrpgacy
    srplvsfryedqgplvegqlgennelrltrdaiepctvghrryftfgggyvyfeeyaysh
    qlsradittvstfidlnitmledhefvplevytrheikdsglldytevqrrnqlhdlrfa
    didtvih
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nwaC (C:)
    dpaaptspgtpgvaaatqaanggpatpappalgaaptgdpkpkknkkpknptpprpagdn
    atvaaghatlrehlrdikaentdanfyvcppptgatvvqfeqprrcptrpegqnytegia
    vvfkeniapykfkatmyykdvtvsqvrfghrysqfmgifedrapvpfeevidkinakgvc
    rstakyvrnnlettafhrddhetdmelkpanaatrtsrgwhttdlkynpsrveafhrygt
    tvnciveevdarsvypydefvlatgdfvymspfygyregshtehtsyaadrfkqvdgfya
    rdlttkaratapttrnllttpkftvawdwvpkrpsvctmtkwqevdemlrseyggsfrfs
    sdaisttfttnlteyplsrvdlgdcigkdardamdrifarrynathikvgqpqyylangg
    fliayqpllsntlaelyvrehlreqsrkppnptppppgasanasverikttssiefarlq
    ftynhiqrhvndmlgrvaiawcelqnheltlwnearklnpnaiasvtvgrrvsarmlgdv
    mavstcvpvaadnvivqnsmrissrpgacysrplvsfryedqgplvegqlgennelrltr
    daiepctvghrryftfgggyvyfeeyayshqlsradittvstfidlnitmledhefvple
    vytrheikdsglldytevqrrnqlhdlrfadidtvihadanaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nwaC (C:)
    dikaentdanfyvcppptgatvvqfeqprrcptrpegqnytegiavvfkeniapykfkat
    myykdvtvsqvrfghrysqfmgifedrapvpfeevidkinakgvcrstakyvrnnletta
    fhrddhetdmelkpanaatrtsrgwhttdlkynpsrveafhrygttvnciveevdarsvy
    pydefvlatgdfvymspfygyregshtehtsyaadrfkqvdgfyardlttkaratapttr
    nllttpkftvawdwvpkrpsvctmtkwqevdemlrseyggsfrfssdaisttfttnltey
    plsrvdlgdcigkdardamdrifarrynathikvgqpqyylanggfliayqpllsntlae
    lyvrehlreqsrkppverikttssiefarlqftynhiqrhvndmlgrvaiawcelqnhel
    tlwnearklnpnaiasvtvgrrvsarmlgdvmavstcvpvaadnvivqnsmrissrpgac
    ysrplvsfryedqgplvegqlgennelrltrdaiepctvghrryftfgggyvyfeeyays
    hqlsradittvstfidlnitmledhefvplevytrheikdsglldytevqrrnqlhdlrf
    adidtvih
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nwaD (D:)
    dpaaptspgtpgvaaatqaanggpatpappalgaaptgdpkpkknkkpknptpprpagdn
    atvaaghatlrehlrdikaentdanfyvcppptgatvvqfeqprrcptrpegqnytegia
    vvfkeniapykfkatmyykdvtvsqvrfghrysqfmgifedrapvpfeevidkinakgvc
    rstakyvrnnlettafhrddhetdmelkpanaatrtsrgwhttdlkynpsrveafhrygt
    tvnciveevdarsvypydefvlatgdfvymspfygyregshtehtsyaadrfkqvdgfya
    rdlttkaratapttrnllttpkftvawdwvpkrpsvctmtkwqevdemlrseyggsfrfs
    sdaisttfttnlteyplsrvdlgdcigkdardamdrifarrynathikvgqpqyylangg
    fliayqpllsntlaelyvrehlreqsrkppnptppppgasanasverikttssiefarlq
    ftynhiqrhvndmlgrvaiawcelqnheltlwnearklnpnaiasvtvgrrvsarmlgdv
    mavstcvpvaadnvivqnsmrissrpgacysrplvsfryedqgplvegqlgennelrltr
    daiepctvghrryftfgggyvyfeeyayshqlsradittvstfidlnitmledhefvple
    vytrheikdsglldytevqrrnqlhdlrfadidtvihadanaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nwaD (D:)
    dikaentdanfyvcppptgatvvqfeqprrcptrpegqnytegiavvfkeniapykfkat
    myykdvtvsqvrfghrysqfmgifedrapvpfeevidkinakgvcrstakyvrnnletta
    fhrddhetdmelkpanaatrtsrgwhttdlkynpsrveafhrygttvnciveevdarsvy
    pydefvlatgdfvymspfygyregshtehtsyaadrfkqvdgfyardlttkaratapttr
    nllttpkftvawdwvpkrpsvctmtkwqevdemlrseyggsfrfssdaisttfttnltey
    plsrvdlgdcigkdardamdrifarrynathikvgqpqyylanggfliayqpllsntlae
    lyvrehlreqsrkpperikttssiefarlqftynhiqrhvndmlgrvaiawcelqnhelt
    lwnearklnpnaiasvtvgrrvsarmlgdvmavstcvpvaadnvivqnsmrissrpgacy
    srplvsfryedqgplvegqlgennelrltrdaiepctvghrryftfgggyvyfeeyaysh
    qlsradittvstfidlnitmledhefvplevytrheikdsglldytevqrrnqlhdlrfa
    didtvih