PDB entry 3nw5

View 3nw5 on RCSB PDB site
Description: Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a carbon-linked proline isostere inhibitor (11B)
Class: transferase
Keywords: hormone/growth factor, igf-1r, kinase domain, transferase
Deposited on 2010-07-09, released 2010-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-08, with a file datestamp of 2010-09-03.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: 0.196
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin-like growth factor 1 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: IGF1R
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nw5a_
  • Heterogens: LGX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nw5A (A:)
    mvsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaa
    smrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpeme
    nnpvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrd
    iyetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsne
    qvlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsf
    yyseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nw5A (A:)
    dvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmrer
    ieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpemennpvl
    appslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetd
    yyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrf
    vmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyysee
    nk