PDB entry 3nw3

View 3nw3 on RCSB PDB site
Description: Crystal structure of the complex of peptidoglycan recognition protein (PGRP-S) with the PGN Fragment at 2.5 A resolution
Class: immune system
Keywords: Immune response, secreted, antimicrobial, PGRP, Antibiotic, Peptidoglycan Binding, IMMUNE SYSTEM
Deposited on 2010-07-09, released 2010-08-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-13, with a file datestamp of 2012-06-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.236
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidoglycan recognition protein 1
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nw3a_
  • Chain 'B':
    Compound: Peptidoglycan recognition protein 1
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nw3b_
  • Chain 'C':
    Compound: Peptidoglycan recognition protein 1
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nw3c_
  • Chain 'D':
    Compound: Peptidoglycan recognition protein 1
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nw3d_
  • Heterogens: TLA, MU2, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nw3A (A:)
    edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
    vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
    lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nw3B (B:)
    edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
    vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
    lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nw3C (C:)
    edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
    vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
    lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nw3D (D:)
    edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
    vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
    lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra