PDB entry 3nw2

View 3nw2 on RCSB PDB site
Description: Novel nanomolar Imidazopyridines as selective Nitric Oxide Synthase (iNOS) inhibitors: SAR and structural insights
Class: OXIDOREDUCTASE/OXIDOREDUCTASE inhibitor
Keywords: CALMODULIN-BINDING, FAD, FMN, IRON, METAL-BINDING, NADP, OXIDOREDUCTASE-OXIDOREDUCTASE inhibitor complex
Deposited on 2010-07-09, released 2011-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitric oxide synthase, inducible
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nw2a_
  • Chain 'B':
    Compound: Nitric oxide synthase, inducible
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nw2b_
  • Heterogens: HEM, H4B, SO4, MPW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nw2A (A:)
    qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
    aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
    riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
    qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
    pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
    fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
    fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
    nek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nw2A (A:)
    qyvriknwgsgeilhdtlhhkatsdsclgsimnpksltrgprdkptpleellphaiefin
    qyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcigriqwsn
    lqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwnsqlirya
    gyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeippdlvle
    vtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrdfcdtqr
    ynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtasesfmkhmq
    neyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nw2B (B:)
    qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
    aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
    riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
    qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
    pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
    fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
    fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
    nek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nw2B (B:)
    qyvriknwgsgeilhdtlhhkatssclgsimnpksltrgprdkptpleellphaiefinq
    yygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcigriqwsnl
    qvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwnsqliryag
    yqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeippdlvlev
    tmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrdfcdtqry
    nileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtasesfmkhmqn
    eyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq