PDB entry 3nw0

View 3nw0 on RCSB PDB site
Description: crystal structure of mageg1 and nse1 complex
Deposited on 2010-07-09, released 2010-10-13
Made obsolete by 5wy5 on 2017-05-03

The last revision was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: XRAY
Resolution: 2.92 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-structural maintenance of chromosomes element 1 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPC333, HSPC337, NDNL2, NSMCE1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Melanoma-associated antigen G1
    Species: Homo sapiens [TaxId:9606]
    Gene: HCA4, MAGEG1, NDNL2, NSMCE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96MG7 (0-216)
      • engineered mutation (115)
      • engineered mutation (180)
  • Heterogens: MG, ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nw0A (A:)
    gvmtdvhrrflqllmthgvleewdvkrlqthcykvhdrnatvdkledfinninsvlesly
    ieikrgvteddgrpiyalvnlattsiskmatdfaeneldlfrkaleliidsetgfasstn
    ilnlvdqlkgkkmrkkeaeqvlqkfvqnkwliekegeftlhgrailemeqyiretypdav
    kicnichslliqgqscetcgirmhlpcvakyfqsnaeprcphcndywpheipkvfdpe
    

    Sequence, based on observed residues (ATOM records):
    >3nw0A (A:)
    gvmtdvhrrflqllmthgvleewdvkrlqthcykvhnatvdkledfinninsvleslyie
    ikrgvteddgrpiyalvnlattsiskmatdfaeneldlfrkaleliidsetgfasstnil
    nlvdqlkgkkmrkkeaeqvlqkfvqnkwliekegeftlhgrailemeqyiretypdavki
    cnichslliqgqscetcgirmhlpcvakyfqsnaeprcphcndywpheipkvfdpe
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nw0B (B:)
    gprsqkqlelkvselvqfllikdqkkipikradilkhvigdykdifpdlfkraaerlqyv
    fgyklvelepksntyilintlepveedaemrgdqgtpttgllmivlglifmkgntlkete
    awdflrrlgvyptkkhlifgdpkklitedfvrqryleyrriphtdpvdyefqwgprtnle
    lskmkvlkfvakvhnqdpkdwpaqycealadeenrar
    

    Sequence, based on observed residues (ATOM records):
    >3nw0B (B:)
    gprsqkqlelkvselvqfllikdqkkipikradilkhvigdykdifpdlfkraaerlqyv
    fgyklvelepksntyilintlepvemrgqgtpttgllmivlglifmkgntlketeawdfl
    rrlvypkklitedfvrqryleyryefqwgprtnlelskmkvlkfvakvhnqdpkdwpaqy
    cealadeenrar