PDB entry 3nvy

View 3nvy on RCSB PDB site
Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Quercetin
Class: oxidoreductase
Keywords: Hydroxylase, Homodimer, Xanthine Oxidase, Quercetin, OXIDOREDUCTASE
Deposited on 2010-07-08, released 2011-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-03, with a file datestamp of 2014-08-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nvya1, d3nvya2
  • Chain 'B':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nvyb1, d3nvyb2
  • Chain 'C':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nvyc1, d3nvyc2
  • Chain 'J':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nvyj1, d3nvyj2
  • Chain 'K':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nvyk1, d3nvyk2
  • Chain 'L':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nvyl1, d3nvyl2
  • Heterogens: FES, FAD, MTE, MOS, QUE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nvyA (A:)
    tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
    qdkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgiv
    msmytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nvyB (B:)
    lfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqastlkelldlkaqhpe
    aklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfgaacalssvektlle
    avaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisdlnpvfmasgtklti
    vsrgtrrtvpmdhtffpsyrktllgpeeillsieipysredeffsafkqasrreddiakv
    tcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkqlskfwnekllqdvcaglaeel
    slspdapggmiefrrtltlsfffkfyltvlkklg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nvyC (C:)
    dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
    fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
    dlpaiitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethcti
    aipkgeegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsv
    avalaayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagns
    rdlshsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsev
    avtcglpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnke
    ncwkkrglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqva
    skalkipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpd
    gswedwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgd
    hknlrtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykip
    afgsiptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnnt
    kelfrldspatpekirnacvdkfttlcvtgapgnck
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nvyJ (J:)
    tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
    qdkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgiv
    msmytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfak
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3nvyK (K:)
    lfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqastlkelldlkaqhpe
    aklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfgaacalssvektlle
    avaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisdlnpvfmasgtklti
    vsrgtrrtvpmdhtffpsyrktllgpeeillsieipysredeffsafkqasrreddiakv
    tcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkqlskfwnekllqdvcaglaeel
    slspdapggmiefrrtltlsfffkfyltvlkklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nvyK (K:)
    pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
    ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
    svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
    llsieipysredeffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrt
    isalkttqkqlskfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltv
    lkklg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3nvyL (L:)
    dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
    fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
    dlpaiitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethcti
    aipkgeegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsv
    avalaayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagns
    rdlshsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsev
    avtcglpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnke
    ncwkkrglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqva
    skalkipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpd
    gswedwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgd
    hknlrtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykip
    afgsiptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnnt
    kelfrldspatpekirnacvdkfttlcvtgapgnck
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nvyL (L:)
    dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
    fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
    dlpaiitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethcti
    aipkgeegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsv
    avalaayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagns
    rdlshsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsev
    avtcglpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnke
    ncwkkrglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqva
    skalkipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpd
    gswedwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgd
    hknlrtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykip
    afgsiptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnnt
    kelfrldspatpekirnacvdkftt