PDB entry 3nvx

View 3nvx on RCSB PDB site
Description: Molecular mechanism of guidance cue recognition
Deposited on 2010-07-08, released 2010-09-15
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.178
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein A39
    Species: VACCINIA VIRUS [TaxId:10249]
    Gene: A39R
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21062 (1-382)
      • expression tag (0)
  • Chain 'B':
    Compound: Protein A39
    Species: VACCINIA VIRUS [TaxId:10249]
    Gene: A39R
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nvxA (A:)
    siewhkfetseeiistyllddvlytgvngavytfsnnklnktgltnnnyittsikvedad
    kdtlvcgtnngnpkcwkidgsddpkhrgrgyapyqnskvtiisynecvlsdiniskegik
    rwrrfdgpcgydlytadnvipkdglrgafvdkdgtydkvyilftdtigskrivkipyiaq
    mclndeggpsslsshrwstflkvelecdidgrsyrqiihsrtiktdndtilyvffdspys
    ksalctysmntikqsfstsklegytkqlpspapgiclpagkvvshttfeviekynvlddi
    ikplsnqpifegpsgvkwfdikekenehreyriyfikensiysfdtkskqtrssqvdarl
    fsvmvtskplfiadigigvgmpq
    

    Sequence, based on observed residues (ATOM records):
    >3nvxA (A:)
    siewhkfetseeiistyllddvlytgvngavytfsnnklnktgltnnnyittsikvkdtl
    vcgtnngnpkcwkidgsddpkhrgrgyapyqnskvtiisynecvlsdiniskegikrwrr
    fdgpcgydlytadnvipkdglrgafvdkdgtydkvyilftdtigskrivkipyiaqmcln
    deggpsslsshrwstflkvelecdidgrsyrqiihsrtiktdndtilyvffdspysksal
    ctysmntikqsfstsklegytkqlpspapgiclpagkvvshttfeviekynvlddiikpl
    snqpifegpsgvkwfdikekenehreyriyfikensiysfdtkskqtrssqvdarlfsvm
    vtskplfiadigigvgmpq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nvxB (B:)
    siewhkfetseeiistyllddvlytgvngavytfsnnklnktgltnnnyittsikvedad
    kdtlvcgtnngnpkcwkidgsddpkhrgrgyapyqnskvtiisynecvlsdiniskegik
    rwrrfdgpcgydlytadnvipkdglrgafvdkdgtydkvyilftdtigskrivkipyiaq
    mclndeggpsslsshrwstflkvelecdidgrsyrqiihsrtiktdndtilyvffdspys
    ksalctysmntikqsfstsklegytkqlpspapgiclpagkvvshttfeviekynvlddi
    ikplsnqpifegpsgvkwfdikekenehreyriyfikensiysfdtkskqtrssqvdarl
    fsvmvtskplfiadigigvgmpq
    

    Sequence, based on observed residues (ATOM records):
    >3nvxB (B:)
    iewhkfetseeiistyllddvlytgvngavytfsnnklnktgltnnnyittsikdtlvcg
    tnngnpkcwkidgsddpkhrgrgyapyqnskvtiisynecvlsdiniskegikrwrrfdg
    pcgydlytadnvipkdglrgafvdkdgtydkvyilftdtigskrivkipyiaqmclndeg
    gpsslsshrwstflkvelecdidgrsyrqiihsrtiktdndtilyvffdspysksalcty
    smntikqsfstsklegytkqlpspapgiclpagkvvshttfeviekynvlddiikplsnq
    pifegpsgvkwfdikekreyriyfikensiysfdtkskqtrssqvdarlfsvmvtskplf
    iadigigvgmp