PDB entry 3nvv

View 3nvv on RCSB PDB site
Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Arsenite
Class: oxidoreductase
Keywords: Hydroxylase, Homodimer, Xanthine Oxidase, Arsenite, OXIDOREDUCTASE
Deposited on 2010-07-08, released 2011-01-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.194
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3nvvb1, d3nvvb2
  • Chain 'C':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Xanthine dehydrogenase/oxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FES, FAD, MTE, MOS, AST, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nvvB (B:)
    lfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqastlkelldlkaqhpe
    aklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfgaacalssvektlle
    avaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisdlnpvfmasgtklti
    vsrgtrrtvpmdhtffpsyrktllgpeeillsieipysredeffsafkqasrreddiakv
    tcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkqlskfwnekllqdvcaglaeel
    slspdapggmiefrrtltlsfffkfyltvlkklg
    

  • Chain 'C':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.