PDB entry 3nvu

View 3nvu on RCSB PDB site
Description: Modulating Heme Redox Potential Through Protein-Induced Porphyrin Distortion
Class: Signaling Protein
Keywords: H-NOX, Hemoprotein, Heme, Signaling Protein
Deposited on 2010-07-08, released 2010-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-10-06, with a file datestamp of 2010-10-01.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.192
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methyl-accepting chemotaxis protein
    Species: Thermoanaerobacter tengcongensis [TaxId:119072]
    Gene: Tar4, TTE0680
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RBX6 (0-187)
      • engineered mutation (4)
      • engineered mutation (114)
    Domains in SCOPe 2.07: d3nvua_
  • Chain 'B':
    Compound: methyl-accepting chemotaxis protein
    Species: Thermoanaerobacter tengcongensis [TaxId:119072]
    Gene: Tar4, TTE0680
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RBX6 (0-187)
      • engineered mutation (4)
      • engineered mutation (114)
    Domains in SCOPe 2.07: d3nvub_
  • Heterogens: HEM, OXY, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nvuA (A:)
    mkgtlvgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
    knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatparliak
    pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
    pvfeykkn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nvuB (B:)
    mkgtlvgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
    knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatparliak
    pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
    pvfeykkn