PDB entry 3nvt

View 3nvt on RCSB PDB site
Description: 1.95 angstrom crystal structure of a bifunctional 3-deoxy-7- phosphoheptulonate synthase/chorismate mutase (aroa) from listeria monocytogenes egd-e
Deposited on 2010-07-08, released 2010-07-28
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Gene: aroA, lmo1600
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Gene: aroA, lmo1600
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MN, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nvtA (A:)
    mhhhhhhssgvdlgtenlyfqsnamvntnleelrtqvdqlnidlleliskranlvqeigk
    ikgtqgslrfdplreremlntilaanegpfedstvqklfkeifkaglelqeedhskallv
    srknkkedtivtvkglpigngepvfvfgpcsvesyeqvaavaesikakglklirggafkp
    rtspydfqglgleglkilkrvsdeyglgviseivtpadievaldyvdviqigarnmqnfe
    llkaagrvdkpillkrglsatieefigaaeyimsqgngkiilcergirtyekatrntldi
    savpilkkethlpvmvdvthstgrkdlllpcakaalaieadgvmaevhpdpavalsdsaq
    qmdipefeefwnailasnlvphkik
    

    Sequence, based on observed residues (ATOM records):
    >3nvtA (A:)
    elrtqvdqlnidlleliskranlvqeigkikgrfdplreremlntilaanegpfedstvq
    klfkeifkaglelqeedhskallvsrknkkedtivtvkglpigngepvfvfgpcsvesye
    qvaavaesikakglklirggafkprtspydfqglgleglkilkrvsdeyglgviseivtp
    adievaldyvdviqigarnmqnfellkaagrvdkpillkrglsatieefigaaeyimsqg
    ngkiilcergirtyekatrntldisavpilkkethlpvmvdvthstgrkdlllpcakaal
    aieadgvmaevhpdpavalsdsaqqmdipefeefwnailasnlvp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nvtB (B:)
    mhhhhhhssgvdlgtenlyfqsnamvntnleelrtqvdqlnidlleliskranlvqeigk
    ikgtqgslrfdplreremlntilaanegpfedstvqklfkeifkaglelqeedhskallv
    srknkkedtivtvkglpigngepvfvfgpcsvesyeqvaavaesikakglklirggafkp
    rtspydfqglgleglkilkrvsdeyglgviseivtpadievaldyvdviqigarnmqnfe
    llkaagrvdkpillkrglsatieefigaaeyimsqgngkiilcergirtyekatrntldi
    savpilkkethlpvmvdvthstgrkdlllpcakaalaieadgvmaevhpdpavalsdsaq
    qmdipefeefwnailasnlvphkik
    

    Sequence, based on observed residues (ATOM records):
    >3nvtB (B:)
    leelrtqvdqlnidlleliskranlvqemlntilaanegpfedstvqklfkeifkaglel
    qskallvsrknkkedtivtvkglpigngepvfvfgpcsvesyeqvaavaesikakglkli
    rggafkprtspydfqglgleglkilkrvsdeyglgviseivtpadievaldyvdviqiga
    rnmqnfellkaagrvdkpillkrglsatieefigaaeyimsqgngkiilcergirtyeka
    trntldisavpilkkethlpvmvdvthstgrkdlllpcakaalaieadgvmaevhpdpav
    alsdsaqqmdipefeefwnailasnlv