PDB entry 3nvs

View 3nvs on RCSB PDB site
Description: 1.02 Angstrom resolution crystal structure of 3-phosphoshikimate 1-carboxyvinyltransferase from Vibrio cholerae in complex with shikimate-3-phosphate (partially photolyzed) and glyphosate
Class: transferase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, inside-out alpha-beta barrel, EPSP SYNTHASE, TRANSFERASE
Deposited on 2010-07-08, released 2010-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.02 Å
R-factor: N/A
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-phosphoshikimate 1-carboxyvinyltransferase
    Species: Vibrio cholerae [TaxId:666]
    Gene: aroA, NP_231368, VC_1732
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nvsa_
  • Heterogens: S3P, SKM, GPJ, MG, CL, EPE, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nvsA (A:)
    mhhhhhhssgvdlgtenlyfqsnamesltlqpielisgevnlpgsksvsnralllaalas
    gttrltnlldsddirhmlnaltklgvnyrlsadkttceveglgqafhttqplelflgnag
    tamrplaaalclgqgdyvltgeprmkerpighlvdalrqagaqieyleqenfpplriqgt
    glqagtvtidgsissqfltaflmsaplaqgkvtikivgelvskpyiditlhimeqfgvqv
    inhdyqefvipagqsyvspgqflvegdassasyflaaaaikggevkvtgigknsiqgdiq
    fadalekmgaqiewgddyviarrgelnavdldfnhipdaamtiattalfakgttairnvy
    nwrvketdrlaamatelrkvgatveegedfivitpptklihaaidtyddhrmamcfslva
    lsdtpvtindpkctsktfpdyfdkfaqlsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nvsA (A:)
    mesltlqpielisgevnlpgsksvsnralllaalasgttrltnlldsddirhmlnaltkl
    gvnyrlsadkttceveglgqafhttqplelflgnagtamrplaaalclgqgdyvltgepr
    mkerpighlvdalrqagaqieyleqenfpplriqgtglqagtvtidgsissqfltaflms
    aplaqgkvtikivgelvskpyiditlhimeqfgvqvinhdyqefvipagqsyvspgqflv
    egdassasyflaaaaikggevkvtgigknsiqgdiqfadalekmgaqiewgddyviarrg
    elnavdldfnhipdaamtiattalfakgttairnvynwrvketdrlaamatelrkvgatv
    eegedfivitpptklihaaidtyddhrmamcfslvalsdtpvtindpkctsktfpdyfdk
    faqlsr