PDB entry 3nvq

View 3nvq on RCSB PDB site
Description: Molecular mechanism of guidance cue recognition
Deposited on 2010-07-08, released 2010-09-15
The last revision was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.248
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Semaphorin-7A
    Species: Homo sapiens [TaxId:9606]
    Gene: SEMA7A, CD108, SEMAL
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Plexin-C1
    Species: Homo sapiens [TaxId:9606]
    Gene: PLXNC1, VESPR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60486 (0-472)
      • expression tag (473)
  • Chain 'E':
    Compound: Semaphorin-7A
    Species: Homo sapiens [TaxId:9606]
    Gene: SEMA7A, CD108, SEMAL
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Plexin-C1
    Species: Homo sapiens [TaxId:9606]
    Gene: PLXNC1, VESPR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60486 (0-472)
      • expression tag (473)
  • Heterogens: NAG, NDG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nvqA (A:)
    qghlrsgprifavwkghvgqdrvdfgqtephtvlfhepgsssvwvggrgkvylfdfpegk
    nasvrtvnigstkgscldkrdcenyitllerrsegllacgtnarhpscwnlvngtvvplg
    emrgyapfspdenslvlfegdevystirkqeyngkiprfrrirgeselytsdtvmqnpqf
    ikativhqdqayddkiyyffrednpdknpeaplnvsrvaqlcrgdqggesslsvskwntf
    lkamlvcsdaatnknfnrlqdvfllpdpsgqwrdtrvygvfsnpwnysavcvyslgdidk
    vfrtsslkgyhsslpnprpgkclpdqqpiptetfqvadrhpevaqrvepmgplktplfhs
    kyhyqkvavhrmqashgetfhvlylttdrgtihkvvepgeqehsfafnimeiqpfrraaa
    iqtmsldaerrklyvssqwevsqvpldlcevygggchgclmsrdpycgwdqgrcisiyss
    ersvlqsinpaephkecpnpkpdkaplqkvslapnsryylscpmesrhatyswrhkenve
    qscepghqspncilfienltaqqyghyfceaqegsyfreaqhwqllpedg
    

    Sequence, based on observed residues (ATOM records):
    >3nvqA (A:)
    ghlrsgprifavwkghvgqdrvdfgqtephtvlfhepgsssvwvggrgkvylfdfpegkn
    asvrtvnigstkgscldkrdcenyitllerrsegllacgtnarhpscwnlvngtvvplge
    mrgyapfspdenslvlfegdevystirkqeyngkiprfrrirgeselytsdtvmqnpqfi
    kativhqdqayddkiyyffrednpdknpeaplnvsrvaqlcrgdqggesslsvskwntfl
    kamlvcsdaatnknfnrlqdvfllpdpsgqwrdtrvygvfsnpwnysavcvyslgdidkv
    frtsslkgyhsslpnprpgkclpdqqpiptetfqvadrhpevaqrvepmgplktplfhsk
    yhyqkvavhrmqashgetfhvlylttdrgtihkvvepgeqehsfafnimeiqpfrraaai
    qtmsldaerrklyvssqwevsqvpldlcevygggchgclmsrdpycgwdqgrcisiysse
    rsvlqsinpaephkecpnpkpdkaplqkvslapnsryylscpmesrhatyswrhkenveq
    scepghqspncilfienltaqqyghyfceaqegsyfreaqhwqllped
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nvqB (B:)
    adepvwrseqaigaiaasqedgvfvasgscldqldyslehslsrlyrdqagnctepvsla
    pparprpgssfsklllpyregaaglggllltgwtfdrgacevrplgnlsrnslrngtevv
    schpqgstagvvyragrnnrwylavaatyvlpepetasrcnpaasdhdtaialkdtegrs
    latqelgrlklcegagslhfvdaflwngsiyfpyypynytsgaatgwpsmariaqstevl
    fqgqasldcghghpdgrrlllssslvealdvwagvfsaaagegqerrsptttalclfrms
    eiqarakrvswdfktaeshckegdqpervqpiasstlihsdltsvygtvvmnrtvlflgt
    gdgqllkvilgenltsncpeviyeikeetpvfyklvpdpvkniyiyltagkevrrirvan
    cnkhkscsecltatdphcgwchslqrctfqgdcvhsenlenwldissgakkcpgap
    

    Sequence, based on observed residues (ATOM records):
    >3nvqB (B:)
    adepvwrseqaigaiaasqedgvfvasgscldqldyslehslsrlyrdqagnctepvsla
    pparprpgssfsklllpyregaaglggllltgwtfdrgacevrplgnlsrnslrngtevv
    schpqgstagvvyragrnnrwylavaatyvlpepetasrcnpaasdhdtaialkdtegrs
    latqelgrlklcegagslhfvdaflwngsiyfpyypynytsgaatgwpsmariaqstevl
    fqgqasldcghghpdgrrlllssslvealdvwagvfsaaagegqerrsptttalclfrms
    eiqarakrvswdfktaeshckegdqpervqpiasstlihsdltsvygtvvmnrtvlflgt
    gdgqllkvilgenltsncpeviyeikeetpvfyklvpdpvkniyiyltagkevrrirvan
    cnkhkscsecltatdphcgwchslqrctfqgdcvhsenlenwldissgakkcpg
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3nvqE (E:)
    qghlrsgprifavwkghvgqdrvdfgqtephtvlfhepgsssvwvggrgkvylfdfpegk
    nasvrtvnigstkgscldkrdcenyitllerrsegllacgtnarhpscwnlvngtvvplg
    emrgyapfspdenslvlfegdevystirkqeyngkiprfrrirgeselytsdtvmqnpqf
    ikativhqdqayddkiyyffrednpdknpeaplnvsrvaqlcrgdqggesslsvskwntf
    lkamlvcsdaatnknfnrlqdvfllpdpsgqwrdtrvygvfsnpwnysavcvyslgdidk
    vfrtsslkgyhsslpnprpgkclpdqqpiptetfqvadrhpevaqrvepmgplktplfhs
    kyhyqkvavhrmqashgetfhvlylttdrgtihkvvepgeqehsfafnimeiqpfrraaa
    iqtmsldaerrklyvssqwevsqvpldlcevygggchgclmsrdpycgwdqgrcisiyss
    ersvlqsinpaephkecpnpkpdkaplqkvslapnsryylscpmesrhatyswrhkenve
    qscepghqspncilfienltaqqyghyfceaqegsyfreaqhwqllpedg
    

    Sequence, based on observed residues (ATOM records):
    >3nvqE (E:)
    ghlrsgprifavwkghvgqdrvdfgqtephtvlfhepgsssvwvggrgkvylfdfpegkn
    asvrtvnigstkgscldkrdcenyitllerrsegllacgtnarhpscwnlvngtvvplge
    mrgyapfspdenslvlfegdevystirkqeyngkiprfrrirgeselytsdtvmqnpqfi
    kativhqdqayddkiyyffrednpdknpeaplnvsrvaqlcrgdqggesslsvskwntfl
    kamlvcsdaatnknfnrlqdvfllpdpsgqwrdtrvygvfsnpwnysavcvyslgdidkv
    frtsslkgyhsslpnprpgkclpdqqpiptetfqvadrhpevaqrvepmgplktplfhsk
    yhyqkvavhrmqashgetfhvlylttdrgtihkvvepgeqehsfafnimeiqpfrraaai
    qtmsldaerrklyvssqwevsqvpldlcevygggchgclmsrdpycgwdqgrcisiysse
    rsvlqsinpaephkecpnpkpdkaplqkvslapnsryylscpmesrhatyswrhkenveq
    scepghqspncilfienltaqqyghyfceaqegsyfreaqhwqllped
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3nvqF (F:)
    adepvwrseqaigaiaasqedgvfvasgscldqldyslehslsrlyrdqagnctepvsla
    pparprpgssfsklllpyregaaglggllltgwtfdrgacevrplgnlsrnslrngtevv
    schpqgstagvvyragrnnrwylavaatyvlpepetasrcnpaasdhdtaialkdtegrs
    latqelgrlklcegagslhfvdaflwngsiyfpyypynytsgaatgwpsmariaqstevl
    fqgqasldcghghpdgrrlllssslvealdvwagvfsaaagegqerrsptttalclfrms
    eiqarakrvswdfktaeshckegdqpervqpiasstlihsdltsvygtvvmnrtvlflgt
    gdgqllkvilgenltsncpeviyeikeetpvfyklvpdpvkniyiyltagkevrrirvan
    cnkhkscsecltatdphcgwchslqrctfqgdcvhsenlenwldissgakkcpgap
    

    Sequence, based on observed residues (ATOM records):
    >3nvqF (F:)
    adepvwrseqaigaiaasqedgvfvasgscldqldyslehslsrlyrdqagnctepvsla
    pparprpgssfsklllpyregaaglggllltgwtfdrgacevrplgnlsrnslrngtevv
    schpqgstagvvyragrnnrwylavaatyvlpepetasrcnpaasdhdtaialkdtegrs
    latqelgrlklcegagslhfvdaflwngsiyfpyypynytsgaatgwpsmariaqstevl
    fqgqasldcghghpdgrrlllssslvealdvwagvfsaaagegqerrsptttalclfrms
    eiqarakrvswdfktaeshckegdqpervqpiasstlihsdltsvygtvvmnrtvlflgt
    gdgqllkvilgenltsncpeviyeikeetpvfyklvpdpvkniyiyltagkevrrirvan
    cnkhkscsecltatdphcgwchslqrctfqgdcvhsenlenwldissgakkcpg