PDB entry 3nvo

View 3nvo on RCSB PDB site
Description: The Soluble Domain Structure of the ZntB Zn2+ Efflux System
Deposited on 2010-07-08, released 2011-03-23
The last revision was dated 2011-03-23, with a file datestamp of 2011-03-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.204
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc transport protein zntB
    Species: Salmonella enterica [TaxId:90371]
    Gene: zntB, STM1656
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EYX5 (2-263)
      • expression tag (0-1)
  • Chain 'B':
    Compound: Zinc transport protein zntB
    Species: Salmonella enterica [TaxId:90371]
    Gene: zntB, STM1656
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EYX5 (2-End)
      • expression tag (0-1)
  • Heterogens: SO4, ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nvoA (A:)
    ghmeaikgsdvnvpdavfawlldgrggvkpledndvidsqhpcwlhlnythpdsarwlas
    tpllpnnvrdalagessrprvsrmgegtlitlrcingstderpdqlvamrlymderfivs
    trqrkvlalddvvsdlqegtgpvdcggwlvdvcdaltdhasefieelhdkiidlednlld
    qqipprgflallrkqlivmrrymapqrdvyarlaserlpwmsddhrrrmqdiadrlgrgl
    deidaciartgimadeiaqvmqes
    

    Sequence, based on observed residues (ATOM records):
    >3nvoA (A:)
    ghmeaikgsdvnvpdavfawlldgrggvkpledndvidsqhpcwlhlnythpdsarwlas
    tpllpnnvrdalagessrprvsrmgegtlitlrcilvamrlymderfivstrqrkvlald
    dvvsdlqegtgpvdcggwlvdvcdaltdhasefieelhdkiidlednqipprgflallrk
    qlivmrrymapqrdvyarlaserlpwmsddhrrrmqdiadrlgrgldeidaciartgima
    deiaqvmqes
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nvoB (B:)
    ghmeaikgsdvnvpdavfawlldgrggvkpledndvidsqhpcwlhlnythpdsarwlas
    tpllpnnvrdalagessrprvsrmgegtlitlrcingstderpdqlvamrlymderfivs
    trqrkvlalddvvsdlqegtgpvdcggwlvdvcdaltdhasefieelhdkiidlednlld
    qqipprgflallrkqlivmrrymapqrdvyarlaserlpwmsddhrrrmqdiadrlgrgl
    deidaciartgimadeiaqvmqes
    

    Sequence, based on observed residues (ATOM records):
    >3nvoB (B:)
    ghmeaikgsdvnvpdavfawlldgrggvkpledndvidsqhpcwlhlnythpdsarwlas
    tpllpnnvrdalagessrprvsrmgegtlitlrcilvamrlymderfivstrqrkvlald
    dvvsdlqegtgpvdcggwlvdvcdaltdhasefieelhdkiidlednlldqprgflallr
    kqlivmrrymapqrdvyarlaserlpwmsddhrrrmqdiadrlgrgldeidaciartgim
    adeiaqv