PDB entry 3nvn

View 3nvn on RCSB PDB site
Description: Molecular mechanism of guidance cue recognition
Deposited on 2010-07-08, released 2010-09-15
The last revision was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.239
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: evm139
    Species: Ectromelia virus [TaxId:12643]
    Gene: SEMA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8JL80 (4-End)
      • expression tag (3)
  • Chain 'B':
    Compound: Plexin-C1
    Species: Homo sapiens [TaxId:9606]
    Gene: PLXNC1, VESPR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60486 (Start-472)
      • expression tag (473-475)
  • Heterogens: NDG, CA, NAG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nvnA (A:)
    pgtsiewhkfetseeiistyliddvlytgvngavytfsnnelnktgltnnnnyittsikv
    edtlvcgtnngnpkcwkidgsedpkyrgrgyapyqnskvtiishnecvlsdiniskegik
    rwrrfdgpcgydlytadnvipkdgvrgafvdkdgtydkvyilftdtidtkrivkipyiaq
    mclndeggpsslsshrwstflkvelecdidgrsyrqiihskaiktdndtilyvffdspys
    ksalctysmnaikhsfstsklggytkqlpspapgiclpagkvvphttfdiieqynelddi
    ikplsqpifegpsgvkwfdikekenehreyriyfikentiysfdtkskqtrsaqvdarlf
    svmvtskplfiadigigvgiprmkkilkm
    

    Sequence, based on observed residues (ATOM records):
    >3nvnA (A:)
    siewhkfetseeiistyliddvlytgvngavytfsnnelnktgltnnnnyittsikvedt
    lvcgtnngnpkcwkidgsedpkyrgrgyapyqnskvtiishnecvlsdiniskegikrwr
    rfdgpcgydlytadnvipkdgvrgafvdkdgtydkvyilftdtidtkrivkipyiaqmcl
    ndeggpsslsshrwstflkvelecdidgrsyrqiihskaiktdndtilyvffdspysksa
    lctysmnaikhsfstsklggytkqlpspapgiclpagkvvphttfdiieqynelddiikp
    lsqpifegpsgvkwfdikekenehreyriyfikentiysfdtkskqtrsaqvdarlfsvm
    vtskplfiadigigvgiprmkki
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nvnB (B:)
    adepvwrseqaigaiaasqedgvfvasgscldqldyslehslsrlyrdqagnctepvsla
    pparprpgssfsklllpyregaaglggllltgwtfdrgacevrplgnlsrnslrngtevv
    schpqgstagvvyragrnnrwylavaatyvlpepetasrcnpaasdhdtaialkdtegrs
    latqelgrlklcegagslhfvdaflwngsiyfpyypynytsgaatgwpsmariaqstevl
    fqgqasldcghghpdgrrlllssslvealdvwagvfsaaagegqerrsptttalclfrms
    eiqarakrvswdfktaeshckegdqpervqpiasstlihsdltsvygtvvmnrtvlflgt
    gdgqllkvilgenltsncpeviyeikeetpvfyklvpdpvkniyiyltagkevrrirvan
    cnkhkscsecltatdphcgwchslqrctfqgdcvhsenlenwldissgakkcpgap
    

    Sequence, based on observed residues (ATOM records):
    >3nvnB (B:)
    epvwrseqaigaiaasqedgvfvasgscldqldyslehslsrlyrdqagnctepvslapp
    arprpgssfsklllpyregaaglggllltgwtfdrgacevrplgnlsrnslrngtevvsc
    hpqgstagvvyragrnnrwylavaatyvlpepetasrcnpaasdhdtaialkdtegrsla
    tqelgrlklcegagslhfvdaflwngsiyfpyypynytsgaatgwpsmariaqstevlfq
    gqasldcghghpdgrrlllssslvealdvwagvfsaaagegqerrsptttalclfrmsei
    qarakrvswdfktaeshckegdqpervqpiasstlihsdltsvygtvvmnrtvlflgtgd
    gqllkvilgenltsncpeviyeikeetpvfyklvpdpvkniyiyltagkevrrirvancn
    khkscsecltatdphcgwchslqrctfqgdcvhsenlenwldissgakkcpgap