PDB entry 3nvl

View 3nvl on RCSB PDB site
Description: Crystal Structure of Phosphoglycerate Mutase from Trypanosoma brucei
Deposited on 2010-07-08, released 2011-07-27
The last revision was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.168
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
    Species: TRYPANOSOMA BRUCEI [TaxId:185431]
    Gene: Tb10.6k15.2620
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
    Species: TRYPANOSOMA BRUCEI [TaxId:185431]
    Gene: Tb10.6k15.2620
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, CO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nvlA (A:)
    mgsshhhhhhssglvprgshmaltlaahktlprrklvlvvldgvgigprdeydavhvakt
    plmdalfndpkhfrsicahgtavglptdadmgnsevghnalgagrvvlqgaslvddales
    geiftsegyrylhgafsqpgrtlhligllsdggvhsrdnqvyqilkhagangakrirvha
    lydgrdvpdktsfkftdeleevlaklreggcdariasgggrmfvtmdryeadwsivergw
    raqvlgegrafksarealtkfreedanisdqyyppfviagddgrpigtiedgdavlcfnf
    rgdrviemsrafeeeefdkfnrvrlpkvryagmmrydgdlgipnnflvpppkltrtseey
    ligsgcnifalsetqkfghvtyfwngnrsgklseeretfceipsdrvqfnqkplmkskei
    tdaavdaiksgkydmirinypngdmvghtgdlkatitsleavdqslqrlkeavdsvngvf
    litadhgnsddmvqrdkkgkpvrdaegnlmpltshtlapvpvfiggagldprvqmrtdlp
    raglanvtatfinlmgfeapsdyepslieva
    

    Sequence, based on observed residues (ATOM records):
    >3nvlA (A:)
    ltlaahktlprrklvlvvldgvgigprdeydavhvaktplmdalfndpkhfrsicahgta
    vglptdadmgnsevghnalgagrvvlqgaslvddalesgeiftsegyrylhgafsqpgrt
    lhligllsdggvhsrdnqvyqilkhagangakrirvhalydgrdvpdktsfkftdeleev
    laklreggcdariasgggrmfvtmdryeadwsivergwraqvlgegrafksarealtkfr
    eedanisdqyyppfviagddgrpigtiedgdavlcfnfrgdrviemsrafeeeefdkfnr
    vrlpkvryagmmrydgdlgipnnflvpppkltrtseeyligsgcnifalsetqkfghvty
    fwngnrsgklseeretfceipsdrvqfnqkplmkskeitdaavdaiksgkydmirinypn
    gdmvghtgdlkatitsleavdqslqrlkeavdsvngvflitadhgnsddmvqrdkkgkpv
    rdaegnlmpltshtlapvpvfiggagldprvqmrtdlpraglanvtatfinlmgfeapsd
    yepslieva
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nvlB (B:)
    mgsshhhhhhssglvprgshmaltlaahktlprrklvlvvldgvgigprdeydavhvakt
    plmdalfndpkhfrsicahgtavglptdadmgnsevghnalgagrvvlqgaslvddales
    geiftsegyrylhgafsqpgrtlhligllsdggvhsrdnqvyqilkhagangakrirvha
    lydgrdvpdktsfkftdeleevlaklreggcdariasgggrmfvtmdryeadwsivergw
    raqvlgegrafksarealtkfreedanisdqyyppfviagddgrpigtiedgdavlcfnf
    rgdrviemsrafeeeefdkfnrvrlpkvryagmmrydgdlgipnnflvpppkltrtseey
    ligsgcnifalsetqkfghvtyfwngnrsgklseeretfceipsdrvqfnqkplmkskei
    tdaavdaiksgkydmirinypngdmvghtgdlkatitsleavdqslqrlkeavdsvngvf
    litadhgnsddmvqrdkkgkpvrdaegnlmpltshtlapvpvfiggagldprvqmrtdlp
    raglanvtatfinlmgfeapsdyepslieva
    

    Sequence, based on observed residues (ATOM records):
    >3nvlB (B:)
    ltlaahktlprrklvlvvldgvgigprdeydavhvaktplmdalfndpkhfrsicahgta
    vglptdadmgnsevghnalgagrvvlqgaslvddalesgeiftsegyrylhgafsqpgrt
    lhligllsdggvhsrdnqvyqilkhagangakrirvhalydgrdvpdktsfkftdeleev
    laklreggcdariasgggrmfvtmdryeadwsivergwraqvlgegrafksarealtkfr
    eedanisdqyyppfviagddgrpigtiedgdavlcfnfrgdrviemsrafeeeefdkfnr
    vrlpkvryagmmrydgdlgipnnflvpppkltrtseeyligsgcnifalsetqkfghvty
    fwngnrsgklseeretfceipsdrvqfnqkplmkskeitdaavdaiksgkydmirinypn
    gdmvghtgdlkatitsleavdqslqrlkeavdsvngvflitadhgnsddmvqrdkkgkpv
    rdaegnlmpltshtlapvpvfiggagldprvqmrtdlpraglanvtatfinlmgfeapsd
    yepslieva