PDB entry 3nvj

View 3nvj on RCSB PDB site
Description: Crystal structure of the C143A/C166A mutant of Ero1p
Deposited on 2010-07-08, released 2010-11-03
The last revision was dated 2010-11-03, with a file datestamp of 2010-10-29.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.244
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoplasmic oxidoreductin-1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ERO1, YML130C, YM4987.05C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03103 (17-385)
      • expression tag (15-16)
      • engineered mutation (104)
  • Heterogens: NEN, FAD, CD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nvjA (A:)
    gshhhhhhssglvprgsfnelnainenirddlsallksdffkyfrldlykqcsfwdandg
    lclnracsvdvvedwdtlpeywqpeilgsfnndtmkeaddsddeakfldqlcqtskkpvd
    iedtinyadvndfngknavlidltanperftgyggkqagqiwstiyqdncftigetgesl
    akdafyrlvsgfhasigthlskeylntktgkwepnldlfmarignfpdrvtnmyfnyavv
    akalwkiqpylpefsfcdlvnkeiknkmdnvisqldtkifnedlvfandlsltlkdefrs
    rfknvtkimdcvqcdrcrlwgkiqttgyatalkilfeindadeftkqhivgkltkyelia
    llqtfgrlsesiesvnmfekmygkrllerphrd
    

    Sequence, based on observed residues (ATOM records):
    >3nvjA (A:)
    gsfnelnainenirddlsallksdffkyfrldlykqcsfwdandglclnracsvdvvedw
    dtlpeywqpeilgsfnndtmkeaddsddeakfldqlcqtsknavlidltanperftgygg
    kqagqiwstiyqdncftigetgeslakdafyrlvsgfhasigthlskeylntktgkwepn
    ldlfmarignfpdrvtnmyfnyavvakalwkiqpylpefsfcdlvnkeiknkmdnvisql
    dtkifnedlvfandlsltlkdefrsrfknvtkimdcvqcdrcrlwgkiqttgyatalkil
    feindadeftkqhivgkltkyeliallqtfgrlsesiesvnmfekmygkrl