PDB entry 3nvd

View 3nvd on RCSB PDB site
Description: Structure of YBBD in complex with pugnac
Deposited on 2010-07-08, released 2010-08-04
The last revision was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.191
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized lipoprotein ybbD
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ybbD
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Uncharacterized lipoprotein ybbD
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ybbD
    Database cross-references and differences (RAF-indexed):
  • Heterogens: OAN, PG4, NA, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nvdA (A:)
    mrpvfplilsavlflscffgarqteasaskraidanqivnrmsldeklgqmlmpdfrnwq
    kegesspqaltkmndevaslvkkyqfggiilfaenvkttkqtvqltddyqkaspkiplml
    sidqeggivtrlgegtnfpgnmalgaarsrinayqtgsiigkelsalgintdfspvvdin
    nnpdnpvigvrsfssnreltsrlglytmkglqrqdiasalkhfpghgdtdvdshyglplv
    shgqerlrevelypfqkaidagadmvmtahvqfpafddttykskldgsdilvpatlskkv
    mtgllrqemgfngvivtdalnmkaiadhfgqeeavvmavkagvdialmpasvtslkeeqk
    farviqalkeavkngdipeqqinnsveriislkikrgmyparnsdstkekiakakkivgs
    kqhlkaekklaekavtvlkneqhtlpfkpkkgsrilivapyeeqtasieqtihdlikrkk
    ikpvslskmnfasqvfktehekqvkeadyiitgsyvvkndpvvndgviddtisdsskwat
    vfpravmkaalqhnkpfvlmslrnpydaanfeeakaliavygfkgyangrylqpnipagv
    maifgqakpkgtlpvdipsvtkpgntlyplgyglniktgrpl
    

    Sequence, based on observed residues (ATOM records):
    >3nvdA (A:)
    asaskraidanqivnrmsldeklgqmlmpdfrnwqkegesspqaltkmndevaslvkkyq
    fggiilfaenvkttkqtvqltddyqkaspkiplmlsidqeggivtrlgegtnfpgnmalg
    aarsrinayqtgsiigkelsalgintdfspvvdinnnpdnpvigvrsfssnreltsrlgl
    ytmkglqrqdiasalkhfpghgdtdvdshyglplvshgqerlrevelypfqkaidagadm
    vmtahvqfpafddttykskldgsdilvpatlskkvmtgllrqemgfngvivtdalnmkai
    adhfgqeeavvmavkagvdialmpasvtslkeeqkfarviqalkeavkngdipeqqinns
    veriislkikrgmyparnsdstkekiakakkivgskqhlkaekklaekavtvlkneqhtl
    pfkpkkgsrilivapyeeqtasieqtihdlikrkkikpvslskmnfasqvfktehekqvk
    eadyiitgsyvvkndpvvndgviddtisdsskwatvfpravmkaalqhnkpfvlmslrnp
    ydaanfeeakaliavygfkgyangrylqpnipagvmaifgqakpkgtlpvdipsvtkpgn
    tlyplgyglniktgrpl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nvdB (B:)
    mrpvfplilsavlflscffgarqteasaskraidanqivnrmsldeklgqmlmpdfrnwq
    kegesspqaltkmndevaslvkkyqfggiilfaenvkttkqtvqltddyqkaspkiplml
    sidqeggivtrlgegtnfpgnmalgaarsrinayqtgsiigkelsalgintdfspvvdin
    nnpdnpvigvrsfssnreltsrlglytmkglqrqdiasalkhfpghgdtdvdshyglplv
    shgqerlrevelypfqkaidagadmvmtahvqfpafddttykskldgsdilvpatlskkv
    mtgllrqemgfngvivtdalnmkaiadhfgqeeavvmavkagvdialmpasvtslkeeqk
    farviqalkeavkngdipeqqinnsveriislkikrgmyparnsdstkekiakakkivgs
    kqhlkaekklaekavtvlkneqhtlpfkpkkgsrilivapyeeqtasieqtihdlikrkk
    ikpvslskmnfasqvfktehekqvkeadyiitgsyvvkndpvvndgviddtisdsskwat
    vfpravmkaalqhnkpfvlmslrnpydaanfeeakaliavygfkgyangrylqpnipagv
    maifgqakpkgtlpvdipsvtkpgntlyplgyglniktgrpl
    

    Sequence, based on observed residues (ATOM records):
    >3nvdB (B:)
    asaskraidanqivnrmsldeklgqmlmpdfrnwqkegesspqaltkmndevaslvkkyq
    fggiilfaenvkttkqtvqltddyqkaspkiplmlsidqeggivtrlgegtnfpgnmalg
    aarsrinayqtgsiigkelsalgintdfspvvdinnnpdnpvigvrsfssnreltsrlgl
    ytmkglqrqdiasalkhfpghgdtdvdshyglplvshgqerlrevelypfqkaidagadm
    vmtahvqfpafddttykskldgsdilvpatlskkvmtgllrqemgfngvivtdalnmkai
    adhfgqeeavvmavkagvdialmpasvtslkeeqkfarviqalkeavkngdipeqqinns
    veriislkikrgmyparnsdstkekiakakkivgskqhlkaekklaekavtvlkneqhtl
    pfkpkkgsrilivapyeeqtasieqtihdlikrkkikpvslskmnfasqvfktehekqvk
    eadyiitgsyvvkndpvvndgviddtisdsskwatvfpravmkaalqhnkpfvlmslrnp
    ydaanfeeakaliavygfkgyangrylqpnipagvmaifgqakpkgtlpvdipsvtkpgn
    tlyplgyglniktgrpl