PDB entry 3nvc

View 3nvc on RCSB PDB site
Description: Crystal Structure of Salicylate 1,2-dioxygenase G106A mutant from Pseudoaminobacter salicylatoxidans in complex with salicylate
Class: oxidoreductase
Keywords: Beta-Barrel, oxidoreductase
Deposited on 2010-07-08, released 2011-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gentisate 1,2-dioxygenase
    Species: Pseudaminobacter salicylatoxidans [TaxId:93369]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q67FT0
      • engineered mutation (105)
      • conflict (162)
    Domains in SCOPe 2.07: d3nvca_
  • Heterogens: FE2, SAL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nvcA (A:)
    mqnekldhesvtqamqpkdtpelralyksfeeesiiplwtqlgdlmpihpkskavphvwk
    wstllrlarksgelvpvgrggerralglanpglggnayisptmwaaiqylgpretapehr
    hsqnafrfvvegegvwtvvngdpvrmsrgdllltpgwcfhghmndtdqpmawidgldipf
    sqqmdvgffefgsdrvtdyatpnfsrgerlwchpglrplsglqntvaspigayrweftdr
    alteqllledegqpatvapghaairyvnpttggdvmptlrcefhrlragtetatrnevgs
    tvfqvfegagavvmngettklekgdmfvvpswvpwslqaetqfdlfrfsdapimealsfm
    rtkiegqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nvcA (A:)
    mqpkdtpelralyksfeeesiiplwtqlgdlmpihpkskavphvwkwstllrlarksgel
    vpvgrggerralglanpglggnayisptmwaaiqylgpretapehrhsqnafrfvvegeg
    vwtvvngdpvrmsrgdllltpgwcfhghmndtdqpmawidgldipfsqqmdvgffefgsd
    yatpnfsrgerlwchpglrplsglqntvaspigayrweftdralteqllledegqpatva
    pghaairyvnpttggdvmptlrcefhrlragtetatrnevgstvfqvfegagavvmnget
    tklekgdmfvvpswvpwslqaetqfdlfrfsdapimealsfmrtkiegq