PDB entry 3nvb

View 3nvb on RCSB PDB site
Description: Crystal structure of N-terminal part of the protein BF1531 from Bacteroides fragilis containing phosphatase domain complexed with Mg and tungstate
Deposited on 2010-07-08, released 2010-07-28
The last revision was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.184
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Bacteroides fragilis [TaxId:817]
    Gene: BF1531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64W45 (3-End)
      • expression tag (2)
  • Heterogens: MG, WO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nvbA (A:)
    mslytfkelkratkqdtvslpklkvallgdtatqllataikgegilrnynielweaeynq
    verqimdptsdyyqfepdytiifhsthkllekhslvnsdlqnkladdrldfvrllceqgi
    grviyynypeiedtiwgsyatkvqssftyqltklnyelmnisqaypnfficnlagisaky
    grnfmfdssvyvnteiilsldalpiissrtidiiaaiqgkfkkclildldntiwggvvgd
    dgweniqvghglgigkaftefqewvkklknrgiiiavcsknnegkakepfernpemvlkl
    ddiavfvanwenkadnirtiqrtlnigfdsmvflddnpfernmvrehvpgvtvpelpedp
    gdyleylytlnlfetasfseghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nvbA (A:)
    lytfkelkratkqdtvslpklkvallgdtatqllataikgegilrnynielweaeynqve
    rqimdptsdyyqfepdytiifhsthkllekhslvnsdlqnkladdrldfvrllceqgigr
    viyynypeiedtiwgsyatkvqssftyqltklnyelmnisqaypnfficnlagisakygr
    nfmfdssvyvnteiilsldalpiissrtidiiaaiqgkfkkclildldntiwggvvgddg
    weniqvghglgigkaftefqewvkklknrgiiiavcsknnegkakepfernpemvlkldd
    iavfvanwenkadnirtiqrtlnigfdsmvflddnpfernmvrehvpgvtvpelpedpgd
    yleylytlnlfeta