PDB entry 3nva

View 3nva on RCSB PDB site
Description: dimeric form of ctp synthase from sulfolobus solfataricus
Deposited on 2010-07-08, released 2010-09-08
The last revision was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.21
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CTP synthase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: pyrG, SSO0201
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: CTP synthase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: pyrG, SSO0201
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nvaA (A:)
    mpnkyivvtggvlssvgkgtlvasigmllkrrgynvtavkidpyinvdagtmnpymhgev
    fvtedgaetdldlghyerfmdvnmtkynnitagkvyfevikkeregkylgqtvqiiphvt
    dqikdmiryaskinnaeitlveiggtvgdieslpfleavrqlkleegednvifvhialve
    ylsvtgelktkplqhsvqelrrigiqpdfivgratlplddetrrkialftnvkvdhivss
    ydvetsyevpiilesqklvskilsrlkledrqvdltdwisfvnnikginskktinialvg
    kytklkdsyisikeaiyhasayigvrpkliwiestdlesdtknlneilgnvngiivlpgf
    gsrgaegkikaikyarehnipflgicfgfqlsivefardvlglseansteinpntkdpvi
    tlldeqknvtqlggtmrlgaqkiilkegtiayqlygkkvvyerhrhryevnpkyvdiled
    aglvvsgisenglveiielpsnkffvatqahpefksrptnpspiylgfiravasl
    

    Sequence, based on observed residues (ATOM records):
    >3nvaA (A:)
    pnkyivvtggvlssvgkgtlvasigmllkrrgynvtavkidpyinvdagtmnpymhgevf
    vtedgaetdldlghyerfmdvnmtkynnitagkvyfevikkeregkylgqtvqiiphvtd
    qikdmiryaskinnaeitlveiggtvgdieslpfleavrqlkleegednvifvhialvey
    lsvtgelktkplqhsvqelrrigiqpdfivgratlplddetrrkialftnvkvdhivssy
    dvetsyevpiilesqklvskilsrlkledrqvdltdwisfvnnikginskktinialvgk
    ytklkdsyisikeaiyhasayigvrpkliwiestdlesdtknlneilgnvngiivlpgfg
    srgaegkikaikyarehnipflgicfgfqlsivefardvlglseansteinpntkdpvit
    lldeqknvtqlggtmrlgaqkiilkegtiayqlygkkvvyerhrhryevnpkyvdileda
    glvvsgisenglveiielpsnkffvatqahpefksrptnpspiylgfiravas
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nvaB (B:)
    mpnkyivvtggvlssvgkgtlvasigmllkrrgynvtavkidpyinvdagtmnpymhgev
    fvtedgaetdldlghyerfmdvnmtkynnitagkvyfevikkeregkylgqtvqiiphvt
    dqikdmiryaskinnaeitlveiggtvgdieslpfleavrqlkleegednvifvhialve
    ylsvtgelktkplqhsvqelrrigiqpdfivgratlplddetrrkialftnvkvdhivss
    ydvetsyevpiilesqklvskilsrlkledrqvdltdwisfvnnikginskktinialvg
    kytklkdsyisikeaiyhasayigvrpkliwiestdlesdtknlneilgnvngiivlpgf
    gsrgaegkikaikyarehnipflgicfgfqlsivefardvlglseansteinpntkdpvi
    tlldeqknvtqlggtmrlgaqkiilkegtiayqlygkkvvyerhrhryevnpkyvdiled
    aglvvsgisenglveiielpsnkffvatqahpefksrptnpspiylgfiravasl
    

    Sequence, based on observed residues (ATOM records):
    >3nvaB (B:)
    pnkyivvtggvlssvgkgtlvasigmllkrrgynvtavkidpyinvdagtmnpymhgevf
    vtedgaetdldlghyerfmdvnmtkynnitagkvyfevikkeregkylgqtvqiiphvtd
    qikdmiryaskinnaeitlveiggtvgdieslpfleavrqlkleegednvifvhialvey
    lsvtgelktkplqhsvqelrrigiqpdfivgratlplddetrrkialftnvkvdhivssy
    dvetsyevpiilesqklvskilsrlkledrqvdltdwisfvnnikginskktinialvgk
    ytklkdsyisikeaiyhasayigvrpkliwiestdlesdtknlneilgnvngiivlpgfg
    srgaegkikaikyarehnipflgicfgfqlsivefardvlglseansteinpntkdpvit
    lldeqknvtqlggtmrlgaqkiilkegtiayqlygkkvvyerhrhryevnpkyvdileda
    glvvsgisenglveiielpsnkffvatqahpefksrptnpspiylgfiravas