PDB entry 3nv9

View 3nv9 on RCSB PDB site
Description: Crystal structure of Entamoeba histolytica Malic Enzyme
Deposited on 2010-07-08, released 2011-07-20
The last revision was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.183
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malic enzyme
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EHI_044970, EhME
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: malic enzyme
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EHI_044970, EhME
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, NA, GOL, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nv9A (A:)
    maqlkadlsnleeclpstlsqeqravaktqfykelaekvhkfykgkiqimpkctlagfnw
    fnayytpgvsristnirdnndsslfyslrgnfvgvvsdstrvlgdgdvtppgglgvmegk
    allmkylggidavpicidsknkegkndpdaviefvqriqhtfgainledisqpncykild
    vlrescdipvwhddqqgtasvtlagllnalklvkkdihecrmvfigagssnttclrlivt
    agadpkkivmfdskgslhngredikkdtrfyrkweicettnpskfgsiaeacvgadvlis
    lstpgpgvvkaewiksmgekpivfccanpvpeiypyeakeagayivatgrgdfpnqvnns
    vgfpgilkgalivrarkitdnmaiaasralaefaekrginpdniigtmdepgifpkeaad
    vamqaikdgvarvtdltwqqvydiaehdikearesaqllqdskhivdfpqetlneclaya
    inkvtgk
    

    Sequence, based on observed residues (ATOM records):
    >3nv9A (A:)
    maqlkadlsnleeclpstlsqeqravaktqfykelaekvhkfykgkiqimpkctlagfnw
    fnayytpgvsristnirdnndsslfyslrgnfvgvvsdstrvlgdgdvtppgglgvmegk
    allmkylggidavpicidsknkegkndpdaviefvqriqhtfgainledisqpncykild
    vlrescdipvwhddqqgtasvtlagllnalklvkkdihecrmvfigagssnttclrlivt
    agadpkkivmfdskgslhngredikkdtrfyrkweicettnpskfgsiaeacvgadvlis
    lstpgpgvvkaewiksmgekpivfccanpvpeiypyeakeagayivatgrgdfpnqvnns
    vgfpgilkgalivrarkitdnmaiaasralaefaekrginpdniigtmdepgifpkeaad
    vamqaikdgvarvtdltwqqvydiaehdikearesaqllqdskhivdfpqetlneclaya
    inkvtg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nv9B (B:)
    maqlkadlsnleeclpstlsqeqravaktqfykelaekvhkfykgkiqimpkctlagfnw
    fnayytpgvsristnirdnndsslfyslrgnfvgvvsdstrvlgdgdvtppgglgvmegk
    allmkylggidavpicidsknkegkndpdaviefvqriqhtfgainledisqpncykild
    vlrescdipvwhddqqgtasvtlagllnalklvkkdihecrmvfigagssnttclrlivt
    agadpkkivmfdskgslhngredikkdtrfyrkweicettnpskfgsiaeacvgadvlis
    lstpgpgvvkaewiksmgekpivfccanpvpeiypyeakeagayivatgrgdfpnqvnns
    vgfpgilkgalivrarkitdnmaiaasralaefaekrginpdniigtmdepgifpkeaad
    vamqaikdgvarvtdltwqqvydiaehdikearesaqllqdskhivdfpqetlneclaya
    inkvtgk
    

    Sequence, based on observed residues (ATOM records):
    >3nv9B (B:)
    maqlkadlsnleeclpstlsqeqravaktqfykelaekvhkfykgkiqimpkctlagfnw
    fnayytpgvsristnirdnndsslfyslrgnfvgvvsdstrvlgdgdvtppgglgvmegk
    allmkylggidavpicidsknkegkndpdaviefvqriqhtfgainledisqpncykild
    vlrescdipvwhddqqgtasvtlagllnalklvkkdihecrmvfigagssnttclrlivt
    agadpkkivmfdskgslhngredikkdtrfyrkweicettnpskfgsiaeacvgadvlis
    lstpgpgvvkaewiksmgekpivfccanpvpeiypyeakeagayivatgrgdfpnqvnns
    vgfpgilkgalivrarkitdnmaiaasralaefaekrginpdniigtmdepgifpkeaad
    vamqaikdgvarvtdltwqqvydiaehdikearesaqllqdskhivdfpqetlneclaya
    inkvtg