PDB entry 3nv8

View 3nv8 on RCSB PDB site
Description: The structure of 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase in complex with phosphoenol pyruvate and manganese (thesit-free)
Class: transferase
Keywords: DAH7P synthase, Shikimate pathway, Aromatic amino-acid biosynthesis, Evolutionary relationships, Augmented TIM-barrel structure, TIM barrel, Aldolase, Cytosol, TRANSFERASE
Deposited on 2010-07-08, released 2010-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.181
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase AroG
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv2178c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nv8a_
  • Chain 'B':
    Compound: Probable 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase AroG
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv2178c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O53512 (2-463)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d3nv8b1, d3nv8b2
  • Heterogens: SO4, MN, GOL, PEP, CL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nv8A (A:)
    gamnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppv
    tvpseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygas
    mpvvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasa
    amnlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnl
    qtaeiyashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqv
    ianpvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatg
    hqviwqcdpmhgnthesstgfktrhfdrivdevqgffevhralgthpggihveitgenvt
    eclggaqdisetdlagryetacdprlntqqslelaflvaemlrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nv8A (A:)
    mnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppvtv
    pseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygasmp
    vvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasaam
    nlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnlqt
    aeiyashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqvia
    npvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatghq
    viwqcdpmhgnthesstgfktrhfdrivdevqgffevhralgthpggihveitgenvtec
    lggaqdisetdlagryetacdprlntqqslelaflvaemlrd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nv8B (B:)
    gamnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppv
    tvpseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygas
    mpvvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasa
    amnlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnl
    qtaeiyashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqv
    ianpvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatg
    hqviwqcdpmhgnthesstgfktrhfdrivdevqgffevhralgthpggihveitgenvt
    eclggaqdisetdlagryetacdprlntqqslelaflvaemlrd