PDB entry 3nv7

View 3nv7 on RCSB PDB site
Description: Crystal structure of H.pylori phosphopantetheine adenylyltransferase mutant I4V/N76Y
Class: transferase
Keywords: Helicobacter pylori 26695 strain, mutant I4V/N76Y, phosphopantetheine adenylyltransferase, TRANSFERASE
Deposited on 2010-07-08, released 2011-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.19
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: coaD, kdtB, HP_1475
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26010 (Start-156)
      • engineered mutation (3)
      • engineered mutation (75)
    Domains in SCOPe 2.07: d3nv7a_
  • Heterogens: SO4, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3nv7A (A:)
mqkvgiypgtfdpvtnghidiihrsselfeklivavahssaknpmfslderlkmiqlatk
sfknvecvafegllaylakeyhckvlvrglrvvsdfeyelqmgyankslnheletlyfmp
tlqnafisssivrsiiahkgdashlvpkeiypliska

    Sequence, based on observed residues (ATOM records): (download) 
    >3nv7A (A:)
kvgiypgtfdpvtnghidiihrsselfeklivavahssaknpmfslderlkmiqlatksf
knvecvafegllaylakeyhckvlvrglrvvsdfeyelqmgyankslnheletlyfmptl
qnafisssivrsiiahkgdashlvpkeiypliska