PDB entry 3nv5

View 3nv5 on RCSB PDB site
Description: Crystal Structure of Cytochrome P450 CYP101D2
Class: oxidoreductase
Keywords: Cytochrome P450 fold, Oxidizing camphor, OXIDOREDUCTASE
Deposited on 2010-07-08, released 2010-11-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: 0.199
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: Novosphingobium aromaticivorans [TaxId:279238]
    Gene: Saro_1478
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nv5a_
  • Heterogens: HEM, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nv5A (A:)
    mgsshhhhhhssglvprgshmgttrmdtfnpqesrlatnfdeavrakverpanvpedrvy
    eidmyalngiedgyheawkkvqhpgipdliwtpftgghwiatngdtvkevysdptrfsse
    viflpkeagekyqmvptkmdppehtpyrkaldkglnlakirkvedkvrevasslidsfaa
    rgecdfaaeyaelfpvhvfmaladlpledipvlseyarqmtrpegntpeematdleagnn
    gfyayvdpiirarvggdgddlitlmvnseingeriahdkaqglisllllggldtvvnfls
    ffmihlarhpelvaelrsdplklmrgaeemfrrfpvvsearmvakdqeykgvflkrgdmi
    llptalhglddaanpepwkldfsrrsishstfgggphrcagmhlarmevivtleewlkri
    pefsfkegetpiyhsgivaavenvplvwpiar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nv5A (A:)
    akverpanvpedrvyeidmyalngiedgyheawkkvqhpgipdliwtpftgghwiatngd
    tvkevysdptrfsseviflpkeekyqmvptkmdppehtpyrkaldkglnlakirkvedkv
    revasslidsfaargecdfaaeyaelfpvhvfmaladlpledipvlseyarqmtrpepee
    matdleagnngfyayvdpiirarvggdgddlitlmvnseingeriahdkaqglisllllg
    gldtvvnflsffmihlarhpelvaelrsdplklmrgaeemfrrfpvvsearmvakdqeyk
    gvflkrgdmillptalhglddaanpepwkldfsrrsishstfgggphrcagmhlarmevi
    vtleewlkripefsfkegetpiyhsgivaavenvplvwp