PDB entry 3nv3

View 3nv3 on RCSB PDB site
Description: Crystal structure of human galectin-9 C-terminal CRD in complex with biantennary oligosaccharide
Class: Sugar Binding Protein
Keywords: Sugar Binding, Sugar Binding Protein
Deposited on 2010-07-07, released 2010-09-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.188
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin 9 short isoform variant
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nv3a_
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nv3A (A:)
    yphpaypmpfittilgglypsksillsgtvlpsaqrfhinlcsgnhiafhlnprfdenav
    vrntqidnswgseerslprkmpfvrgqsfsvwilceahclkvavdgqhlfeyyhrlrnlp
    tinrlevggdiqlthvqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nv3A (A:)
    hpaypmpfittilgglypsksillsgtvlpsaqrfhinlcsgnhiafhlnprfdenavvr
    ntqidnswgseerslprkmpfvrgqsfsvwilceahclkvavdgqhlfeyyhrlrnlpti
    nrlevggdiqlthvqt