PDB entry 3nv0

View 3nv0 on RCSB PDB site
Description: Crystal structure and mutational analysis of the NXF2/NXT1 heterodimeric complex from caenorhabditis elegans at 1.84 A resolution
Class: RNA binding/Protein transport
Keywords: NTF2-LIKE DOMAIN, BETA SHEET HETERODIMER INTERFACE, NUCLEOPORIN BINDING POCKET, WATER MEDIATED INTERFACE, CATION-PI INTERACTIONS, PI-PI INTERACTIONS, NXF-LOOP, NTF2-PLUG, INTRAMONOMER BURIED WATERS, NOVEL SURFACE EXPOSED POCKETS, MRNA TRANSPORT, NUCLEUS, RNA-BINDING, RNA binding-Protein transport complex
Deposited on 2010-07-07, released 2011-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-18, with a file datestamp of 2012-04-13.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.167
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear RNA export factor 2
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: C15H11.6, nxf-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XVS8 (1-End)
      • expression tag (0)
  • Chain 'B':
    Compound: NTF2-related export protein
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: nxt-1, nxt1, Y71F9AM.5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nv0b_
  • Heterogens: PEG, EDO, NA, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nv0B (B:)
    mgsshhhhhhsqdpnssssmkttqeinkedeelcneskkfmdvyydvmdrkrekigflyt
    qvsnavwngnpingydsicefmkalpstqhdiqsldaqrlpegvtgdmsggmllnvagav
    tvdgdskraftqtlllgvedgkykvksdrfryvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nv0B (B:)
    smkttqeinkedeelcneskkfmdvyydvmdrkrekigflytqvsnavwngnpingydsi
    cefmkalpstqhdiqsldaqrlpegvtgdmsggmllnvagavtvdgdskraftqtlllgv
    edgkykvksdrfryvd