PDB entry 3nuz

View 3nuz on RCSB PDB site
Description: crystal structure of a putative acetyl xylan esterase (bf1801) from bacteroides fragilis nctc 9343 at 2.30 a resolution
Deposited on 2010-07-07, released 2010-08-04
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative acetyl xylan esterase
    Species: Bacteroides fragilis [TaxId:272559]
    Gene: BF1801
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: putative acetyl xylan esterase
    Species: Bacteroides fragilis [TaxId:272559]
    Gene: BF1801
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: putative acetyl xylan esterase
    Species: Bacteroides fragilis [TaxId:272559]
    Gene: BF1801
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: putative acetyl xylan esterase
    Species: Bacteroides fragilis [TaxId:272559]
    Gene: BF1801
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: putative acetyl xylan esterase
    Species: Bacteroides fragilis [TaxId:272559]
    Gene: BF1801
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: putative acetyl xylan esterase
    Species: Bacteroides fragilis [TaxId:272559]
    Gene: BF1801
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nuzA (A:)
    gaqsdgwspkdhnliksvredgrflssygvvhamlrntepryafhrdfspkefrkwqkgl
    rhameeimkfpqiknspapvcikreqregyrlekwefyplpkcvstflvlipdninkpvp
    ailcipgsggnkeglagepgiapklndrykdpkltqalnfvkegyiavavdnpaageasd
    lerytlgsnydydvvsryllelgwsylgyasyldmqvlnwmktqkhirkdrivvsgfslg
    tepmmvlgtldtsiyafvyndflcqtqeraevmtmpdkngrrpfpnsirhlipdfwknfn
    fpdivaalaprpiilteggldrdldlvrkayaivgtpdnvkiyhykkfsdpdtrknveyl
    pegldrneyfrmvnvdgpnhyfkselvvpwlrklleer
    

    Sequence, based on observed residues (ATOM records):
    >3nuzA (A:)
    wspkdhnliksvredgrflssygvvhamlrntepryafhrdfspkefrkwqkglrhamee
    imkfpqspapvcikreqregyrlekwefyplpkcvstflvlipdninkpvpailcipgsg
    gnkeglagepgiapklndrykdpkltqalnfvkegyiavavdnpaageasdlerytlgsn
    ydydvvsryllelgwsylgyasyldmqvlnwmktqkhirkdrivvsgfslgtepmmvlgt
    ldtsiyafvyndflcqtqeraevmtmpdkngrrpfpnsirhlipdfwknfnfpdivaala
    prpiilteggldrdldlvrkayaivgtpdnvkiyhykkfsdpdtrknveylpegldrney
    frmvnvdgpnhyfkselvvpwlrkllee
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nuzB (B:)
    gaqsdgwspkdhnliksvredgrflssygvvhamlrntepryafhrdfspkefrkwqkgl
    rhameeimkfpqiknspapvcikreqregyrlekwefyplpkcvstflvlipdninkpvp
    ailcipgsggnkeglagepgiapklndrykdpkltqalnfvkegyiavavdnpaageasd
    lerytlgsnydydvvsryllelgwsylgyasyldmqvlnwmktqkhirkdrivvsgfslg
    tepmmvlgtldtsiyafvyndflcqtqeraevmtmpdkngrrpfpnsirhlipdfwknfn
    fpdivaalaprpiilteggldrdldlvrkayaivgtpdnvkiyhykkfsdpdtrknveyl
    pegldrneyfrmvnvdgpnhyfkselvvpwlrklleer
    

    Sequence, based on observed residues (ATOM records):
    >3nuzB (B:)
    wspkdhnliksvredgrflssygvvhamlrntepryafhrdfspkefrkwqkglrhamee
    imkfpqispapvcikreqregyrlekwefyplpkcvstflvlipdninkpvpailcipgs
    ggnkeglagepgiapklndrykdpkltqalnfvkegyiavavdnpaageasdlerytlgs
    nydydvvsryllelgwsylgyasyldmqvlnwmktqkhirkdrivvsgfslgtepmmvlg
    tldtsiyafvyndflcqtqeraevmtmpdkngrrpfpnsirhlipdfwknfnfpdivaal
    aprpiilteggldrdldlvrkayaivgtpdnvkiyhykkfsdpdtrknveylpegldrne
    yfrmvnvdgpnhyfkselvvpwlrkllee
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nuzC (C:)
    gaqsdgwspkdhnliksvredgrflssygvvhamlrntepryafhrdfspkefrkwqkgl
    rhameeimkfpqiknspapvcikreqregyrlekwefyplpkcvstflvlipdninkpvp
    ailcipgsggnkeglagepgiapklndrykdpkltqalnfvkegyiavavdnpaageasd
    lerytlgsnydydvvsryllelgwsylgyasyldmqvlnwmktqkhirkdrivvsgfslg
    tepmmvlgtldtsiyafvyndflcqtqeraevmtmpdkngrrpfpnsirhlipdfwknfn
    fpdivaalaprpiilteggldrdldlvrkayaivgtpdnvkiyhykkfsdpdtrknveyl
    pegldrneyfrmvnvdgpnhyfkselvvpwlrklleer
    

    Sequence, based on observed residues (ATOM records):
    >3nuzC (C:)
    wspkdhnliksvredgrflssygvvhamlrntepryafhrdfspkefrkwqkglrhamee
    imkfpqspapvcikreqregyrlekwefyplpkcvstflvlipdninkpvpailcipgsg
    gnkeglagepgiapklndrykdpkltqalnfvkegyiavavdnpaageasdlerytlgsn
    ydydvvsryllelgwsylgyasyldmqvlnwmktqkhirkdrivvsgfslgtepmmvlgt
    ldtsiyafvyndflcqtqeraevmtmpdkngrrpfpnsirhlipdfwknfnfpdivaala
    prpiilteggldrdldlvrkayaivgtpdnvkiyhykkfsdpdtrknveylpegldrney
    frmvnvdgpnhyfkselvvpwlrkllee
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nuzD (D:)
    gaqsdgwspkdhnliksvredgrflssygvvhamlrntepryafhrdfspkefrkwqkgl
    rhameeimkfpqiknspapvcikreqregyrlekwefyplpkcvstflvlipdninkpvp
    ailcipgsggnkeglagepgiapklndrykdpkltqalnfvkegyiavavdnpaageasd
    lerytlgsnydydvvsryllelgwsylgyasyldmqvlnwmktqkhirkdrivvsgfslg
    tepmmvlgtldtsiyafvyndflcqtqeraevmtmpdkngrrpfpnsirhlipdfwknfn
    fpdivaalaprpiilteggldrdldlvrkayaivgtpdnvkiyhykkfsdpdtrknveyl
    pegldrneyfrmvnvdgpnhyfkselvvpwlrklleer
    

    Sequence, based on observed residues (ATOM records):
    >3nuzD (D:)
    wspkdhnliksvredgrflssygvvhamlrntepryafhrdfspkefrkwqkglrhamee
    imkfpqispapvcikreqregyrlekwefyplpkcvstflvlipdninkpvpailcipgs
    ggnkeglagepgiapklndrykdpkltqalnfvkegyiavavdnpaageasdlerytlgs
    nydydvvsryllelgwsylgyasyldmqvlnwmktqkhirkdrivvsgfslgtepmmvlg
    tldtsiyafvyndflcqtqeraevmtmpdkngrrpfpnsirhlipdfwknfnfpdivaal
    aprpiilteggldrdldlvrkayaivgtpdnvkiyhykkfsdpdtrknveylpegldrne
    yfrmvnvdgpnhyfkselvvpwlrkllee
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3nuzE (E:)
    gaqsdgwspkdhnliksvredgrflssygvvhamlrntepryafhrdfspkefrkwqkgl
    rhameeimkfpqiknspapvcikreqregyrlekwefyplpkcvstflvlipdninkpvp
    ailcipgsggnkeglagepgiapklndrykdpkltqalnfvkegyiavavdnpaageasd
    lerytlgsnydydvvsryllelgwsylgyasyldmqvlnwmktqkhirkdrivvsgfslg
    tepmmvlgtldtsiyafvyndflcqtqeraevmtmpdkngrrpfpnsirhlipdfwknfn
    fpdivaalaprpiilteggldrdldlvrkayaivgtpdnvkiyhykkfsdpdtrknveyl
    pegldrneyfrmvnvdgpnhyfkselvvpwlrklleer
    

    Sequence, based on observed residues (ATOM records):
    >3nuzE (E:)
    wspkdhnliksvredgrflssygvvhamlrntepryafhrdfspkefrkwqkglrhamee
    imkfpspapvcikreqregyrlekwefyplpkcvstflvlipdninkpvpailcipgsgg
    nkeglagepgiapklndrykdpkltqalnfvkegyiavavdnpaageasdlerytlgsny
    dydvvsryllelgwsylgyasyldmqvlnwmktqkhirkdrivvsgfslgtepmmvlgtl
    dtsiyafvyndflcqtqeraevmtmpdkngrrpfpnsirhlipdfwknfnfpdivaalap
    rpiilteggldrdldlvrkayaivgtpdnvkiyhykkfsdpdtrknveylpegldrneyf
    rmvnvdgpnhyfkselvvpwlrkll
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3nuzF (F:)
    gaqsdgwspkdhnliksvredgrflssygvvhamlrntepryafhrdfspkefrkwqkgl
    rhameeimkfpqiknspapvcikreqregyrlekwefyplpkcvstflvlipdninkpvp
    ailcipgsggnkeglagepgiapklndrykdpkltqalnfvkegyiavavdnpaageasd
    lerytlgsnydydvvsryllelgwsylgyasyldmqvlnwmktqkhirkdrivvsgfslg
    tepmmvlgtldtsiyafvyndflcqtqeraevmtmpdkngrrpfpnsirhlipdfwknfn
    fpdivaalaprpiilteggldrdldlvrkayaivgtpdnvkiyhykkfsdpdtrknveyl
    pegldrneyfrmvnvdgpnhyfkselvvpwlrklleer
    

    Sequence, based on observed residues (ATOM records):
    >3nuzF (F:)
    wspkdhnliksvredgrflssygvvhamlrntepryafhrdfspkefrkwqkglrhamee
    imkfpqspapvcikreqregyrlekwefyplpkcvstflvlipdninkpvpailcipgsg
    gnkeglagepgiapklndrykdpkltqalnfvkegyiavavdnpaageasdlerytlgsn
    ydydvvsryllelgwsylgyasyldmqvlnwmktqkhirkdrivvsgfslgtepmmvlgt
    ldtsiyafvyndflcqtqeraevmtmpdkngrrpfpnsirhlipdfwknfnfpdivaala
    prpiilteggldrdldlvrkayaivgtpdnvkiyhykkfsdpdtrknveylpegldrney
    frmvnvdgpnhyfkselvvpwlrkll