PDB entry 3nux

View 3nux on RCSB PDB site
Description: CDK6 (monomeric) in complex with inhibitor
Class: transferase/transferase inhibitor
Keywords: Kinase, Protein Kinase, ATP binding, Phosphorylation, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-07-07, released 2010-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.243
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nuxa_
  • Heterogens: 3NV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nuxA (A:)
    mekdglcradqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstir
    evavlrhletfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvpte
    tikdmmfqllrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvv
    vtlwyrapevllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpge
    edwprdvalprqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyf
    qhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nuxA (A:)
    dqqyecvaeigegagkvfkardlknggrfvalkrvrplstirevavlrhletfehpnvvr
    lfdvctkltlvfehvdqdlttyldkvpepgvptetikdmmfqllrgldflhshrvvhrdl
    kpqnilvtssgqikladfglavtlwyrapevllqssyatpvdlwsvgcifaemfrrkplf
    rgssdvdqlgkildviglpgeedwprdvalprqafhksaqpiekfvtdidelgkdlllkc
    ltfnpakrisaysalshpyfq