PDB entry 3nuw

View 3nuw on RCSB PDB site
Description: Crystal structure of 2-oxo-3-deoxygalactonate kinase from Klebsiella pneumoniae
Deposited on 2010-07-07, released 2010-09-01
The last revision was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.174
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-oxo-3-deoxygalactonate kinase
    Species: Klebsiella pneumoniae [TaxId:272620]
    Gene: dgoK, KPN78578_40560, KPN_04097
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6TFZ6 (3-294)
      • expression tag (0-2)
  • Chain 'B':
    Compound: 2-oxo-3-deoxygalactonate kinase
    Species: Klebsiella pneumoniae [TaxId:272620]
    Gene: dgoK, KPN78578_40560, KPN_04097
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 2-oxo-3-deoxygalactonate kinase
    Species: Klebsiella pneumoniae [TaxId:272620]
    Gene: dgoK, KPN78578_40560, KPN_04097
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 2-oxo-3-deoxygalactonate kinase
    Species: Klebsiella pneumoniae [TaxId:272620]
    Gene: dgoK, KPN78578_40560, KPN_04097
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FMT, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3nuwA (A:)
    snamtaryiaidwgstnlrawlyqgeeclesrqseagvtrlngrspaavlaeitqhwrdg
    atpvvmagmvgsnvgwkiapylplpaafsdigqqltavgdniwiipglcvsrddnhnvmr
    geetqllgaralapssvyvmpgthckwvladrrqihdfrtvltgelhhlllqlslvgagl
    ppqetsaaafaaglqrginnpavlpqlfevrashvlgalpreqvseflsglligaevatl
    sdtfagqqaislvagssltsryqqafaaigrevsavagdtafqtgirsiayavan
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nuwB (B:)
    snamtaryiaidwgstnlrawlyqgeeclesrqseagvtrlngrspaavlaeitqhwrdg
    atpvvmagmvgsnvgwkiapylplpaafsdigqqltavgdniwiipglcvsrddnhnvmr
    geetqllgaralapssvyvmpgthckwvladrrqihdfrtvltgelhhlllqlslvgagl
    ppqetsaaafaaglqrginnpavlpqlfevrashvlgalpreqvseflsglligaevatl
    sdtfagqqaislvagssltsryqqafaaigrevsavagdtafqtgirsiayavan
    

    Sequence, based on observed residues (ATOM records):
    >3nuwB (B:)
    mtaryiaidwgstnlrawlyqgeeclesrqseagvtrlngrspaavlaeitqhwrdgatp
    vvmagmvgsnvgwkiapylplpaafsdigqqltavgdniwiipglcvsrddnhnvmrgee
    tqllgaralapssvyvmpgthckwvladrrqihdfrtvltgelhhlllqlslvgaglppq
    etsaaafaaglqrginnpavlpqlfevrashvlgalpreqvseflsglligaevatlsdt
    fagqqaislvagssltsryqqafaaigrevsavagdtafqtgirsiayavan
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nuwC (C:)
    snamtaryiaidwgstnlrawlyqgeeclesrqseagvtrlngrspaavlaeitqhwrdg
    atpvvmagmvgsnvgwkiapylplpaafsdigqqltavgdniwiipglcvsrddnhnvmr
    geetqllgaralapssvyvmpgthckwvladrrqihdfrtvltgelhhlllqlslvgagl
    ppqetsaaafaaglqrginnpavlpqlfevrashvlgalpreqvseflsglligaevatl
    sdtfagqqaislvagssltsryqqafaaigrevsavagdtafqtgirsiayavan
    

    Sequence, based on observed residues (ATOM records):
    >3nuwC (C:)
    mtaryiaidwgstnlrawlyqgeeclesrqseagvtrlngrspaavlaeitqhwrdgatp
    vvmagmvgsnvgwkiapylplpaafsdigqqltavgdniwiipglcvsrddnhnvmrgee
    tqllgaralapssvyvmpgthckwvladrrqihdfrtvltgelhhlllqlslvgaglppq
    etsaaafaaglqrginnpavlpqlfevrashvlgalpreqvseflsglligaevatlsdt
    fagqqaislvagssltsryqqafaaigrevsavagdtafqtgirsiayavan
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nuwD (D:)
    snamtaryiaidwgstnlrawlyqgeeclesrqseagvtrlngrspaavlaeitqhwrdg
    atpvvmagmvgsnvgwkiapylplpaafsdigqqltavgdniwiipglcvsrddnhnvmr
    geetqllgaralapssvyvmpgthckwvladrrqihdfrtvltgelhhlllqlslvgagl
    ppqetsaaafaaglqrginnpavlpqlfevrashvlgalpreqvseflsglligaevatl
    sdtfagqqaislvagssltsryqqafaaigrevsavagdtafqtgirsiayavan
    

    Sequence, based on observed residues (ATOM records):
    >3nuwD (D:)
    mtaryiaidwgstnlrawlyqgeeclesrqseagvtrlngrspaavlaeitqhwrdgatp
    vvmagmvgsnvgwkiapylplpaafsdigqqltavgdniwiipglcvsrddnhnvmrgee
    tqllgaralapssvyvmpgthckwvladrrqihdfrtvltgelhhlllqlslvgaglppq
    etsaaafaaglqrginnpavlpqlfevrashvlgalpreqvseflsglligaevatlsdt
    fagqqaislvagssltsryqqafaaigrevsavagdtafqtgirsiayavan