PDB entry 3nuv

View 3nuv on RCSB PDB site
Description: Crystal structure of ketosteroid isomerase D38ND99N from Pseudomonas testosteroni (tKSI) with 4-Androstene-3,17-dione Bound
Class: isomerase
Keywords: Isomerase
Deposited on 2010-07-07, released 2011-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-23, with a file datestamp of 2011-11-18.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.177
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: steroid delta-isomerase
    Species: Comamonas testosteroni [TaxId:285]
    Gene: ksi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00947 (0-124)
      • engineered mutation (37)
      • engineered mutation (98)
    Domains in SCOPe 2.07: d3nuva_
  • Chain 'B':
    Compound: steroid delta-isomerase
    Species: Comamonas testosteroni [TaxId:285]
    Gene: ksi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00947 (Start-124)
      • engineered mutation (37)
      • engineered mutation (98)
    Domains in SCOPe 2.07: d3nuvb_
  • Heterogens: ASD, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nuvA (A:)
    mntpehmtavvqryvaalnagdldgivalfaddatvenpvgseprsgtaairefyanslk
    lplaveltqevravaneaafaftvsfeyqgrktvvapinhfrfngagkvvsmralfgekn
    ihaga
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nuvB (B:)
    mntpehmtavvqryvaalnagdldgivalfaddatvenpvgseprsgtaairefyanslk
    lplaveltqevravaneaafaftvsfeyqgrktvvapinhfrfngagkvvsmralfgekn
    ihaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nuvB (B:)
    ntpehmtavvqryvaalnagdldgivalfaddatvenpvgseprsgtaairefyanslkl
    plaveltqevravaneaafaftvsfeyqgrktvvapinhfrfngagkvvsmralfgekni
    haga