PDB entry 3nus

View 3nus on RCSB PDB site
Description: phosphoinositide-dependent kinase-1 (PDK1) with fragment8
Class: transferase
Keywords: Kinase domain, TRANSFERASE
Deposited on 2010-07-07, released 2011-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.177
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoinositide-dependent kinase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PkB-like 1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nusa_
  • Heterogens: GOL, JNZ, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nusA (A:)
    qprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerd
    vmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsa
    leylhgkgiihrdlkpenillnedmhiqitdfgtakvlspeskqaransfvgtaqyvspe
    llteksackssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardl
    vekllvldatkrlgceemegygplkahpffesvtwenlhqqtppkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nusA (A:)
    qprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerd
    vmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsa
    leylhgkgiihrdlkpenillnedmhiqitdfgtakvlssfvgtaqyvspellteksack
    ssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlvekllvlda
    tkrlgceemegygplkahpffesvtwenlhqqtppkl