PDB entry 3nuq

View 3nuq on RCSB PDB site
Description: structure of a putative nucleotide phosphatase from saccharomyces cerevisiae
Deposited on 2010-07-07, released 2010-08-18
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative nucleotide phosphatase
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: SDT1, SSM1, YGL224C
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, NA, CL, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nuqA (A:)
    ghmtveytasdlatyqnevneqiaknkahleslthpgskvtfpidqdisatpqnpnlkvf
    ffdidnclyksstrihdlmqqsilrffqthlklspedahvlnnsyykeyglairglvmfh
    kvnaleynrlvddslplqdilkpdiplrnmllrlrqsgkidklwlftnayknhairclrl
    lgiadlfdgltycdysrtdtlvckphvkafekamkesglaryenayfiddsgknietgik
    lgmktcihlvenevneilgqtpegaivisdilelphvvsdlf
    

    Sequence, based on observed residues (ATOM records):
    >3nuqA (A:)
    mtveytasdlatyqnevneqiaknkahleslthpgskvtfpidqpnlkvfffdidnclyk
    sstrihdlmqqsilrffqthlklspedahvlnnsyykeyglairglvmfhkvnaleynrl
    vddslplqdilkpdiplrnmllrlrqsgkidklwlftnayknhairclrllgiadlfdgl
    tycdysrtdtlvckphvkafekamkesglaryenayfiddsgknietgiklgmktcihlv
    enevgqtpegaivisdilelphvvsdlf