PDB entry 3nun

View 3nun on RCSB PDB site
Description: phosphoinositide-dependent kinase-1 (PDK1) with lead compound
Class: transferase/transferase inhibitor
Keywords: Kinase domain, TRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-07-07, released 2011-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-22, with a file datestamp of 2011-06-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.18
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PkB-like
    Species: Homo sapiens [TaxId:9606]
    Gene: PkB-like 1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nuna_
  • Heterogens: GOL, SO4, JMZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nunA (A:)
    haqpppqprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpy
    vtrerdvmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfyt
    aeivsaleylhgkgiihrdlkpenillnedmhiqitdfgtakvlspeskqaransfvgta
    qyvspellteksackssdlwalgciiyqlvaglppfragneylifqkiikleydfpekff
    pkardlvekllvldatkrlgceemegygplkahpffesvtwenlhqqtppkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nunA (A:)
    ppqprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtre
    rdvmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeiv
    saleylhgkgiihrdlkpenillnedmhiqitdfgtakvlssfvgtaqyvspellteksa
    ckssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlvekllvl
    datkrlgceemegygplkahpffesvtwenlhqqtppkl