PDB entry 3nul

View 3nul on RCSB PDB site
Description: Profilin I from Arabidopsis thaliana
Class: actin binding protein
Keywords: profilin, cytoskeleton, actin binding protein
Deposited on 1996-11-27, released 1997-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.181
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: profilin I
    Species: ARABIDOPSIS THALIANA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nula_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nulA (A:)
    swqsyvddhlmcdvegnhltaaailgqdgsvwaqsakfpqlkpqeidgikkdfeepgfla
    ptglflggekymviqgeqgavirgkkgpggvtikktnqalvfgfydepmtggqcnlvver
    lgdyliesel