PDB entry 3nui

View 3nui on RCSB PDB site
Description: Crystal structure of omega-transferase from Vibrio Fluvialis JS17
Class: transferase
Keywords: amino transferase, TRANSFERASE
Deposited on 2010-07-07, released 2011-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-29, with a file datestamp of 2011-06-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate transaminase
    Species: Vibrio fluvialis [TaxId:676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot F2XBU9 (Start-466)
      • expression tag (467)
    Domains in SCOPe 2.07: d3nuia1, d3nuia2
  • Chain 'B':
    Compound: Pyruvate transaminase
    Species: Vibrio fluvialis [TaxId:676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot F2XBU9 (Start-466)
      • expression tag (467-468)
    Domains in SCOPe 2.07: d3nuib1, d3nuib2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nuiA (A:)
    masmtggqqmgrgsmnkpqswearaetyslygftdmpslhqrgtvvvthgegpyivdvng
    rryldansglwnmvagfdhkglidaakaqyerfpgyhaffgrmsdqtvmlseklvevspf
    dsgrvfytnsgseandtmvkmlwflhaaegkpqkrkiltrwnayhgvtavsasmtgkpyn
    svfglplpgfvhltcphywrygeegeteeqfvarlareleetiqregadtiagffaepvm
    gaggvippakgyfqailpilrkydipvisdevicgfgrtgntwgcvtydftpdaiisskn
    ltagffpmgavilgpelskrletaieaieefphgftasghpvgcaialkaidvvmnegla
    envrrlaprfeerlkhiaerpnigeyrgigfmwaleavkdkasktpfdgnlsvseriant
    ctdlglicrplgqsvvlcppfilteaqmdemfdklekaldkvfaevaaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nuiA (A:)
    tvvvthgegpyivdvngrryldansglwnmvagfdhkglidaakaqyerfpgyhaffgrm
    sdqtvmlseklvevspfdsgrvfytnsgseandtmvkmlwflhaaegkpqkrkiltrwna
    yhgvtavsasmtgkpynsvfglplpgfvhltcphywrygeegeteeqfvarlareleeti
    qregadtiagffaepvmgaggvippakgyfqailpilrkydipvisdevicgfgrtgntw
    gcvtydftpdaiissknltagffpmgavilgpelskrletaieaieefphgftasghpvg
    caialkaidvvmneglaenvrrlaprfeerlkhiaerpnigeyrgigfmwaleavkdkas
    ktpfdgnlsvseriantctdlglicrplgqsvvlcppfilteaqmdemfdklekaldkvf
    aevaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nuiB (B:)
    masmtggqqmgrgsmnkpqswearaetyslygftdmpslhqrgtvvvthgegpyivdvng
    rryldansglwnmvagfdhkglidaakaqyerfpgyhaffgrmsdqtvmlseklvevspf
    dsgrvfytnsgseandtmvkmlwflhaaegkpqkrkiltrwnayhgvtavsasmtgkpyn
    svfglplpgfvhltcphywrygeegeteeqfvarlareleetiqregadtiagffaepvm
    gaggvippakgyfqailpilrkydipvisdevicgfgrtgntwgcvtydftpdaiisskn
    ltagffpmgavilgpelskrletaieaieefphgftasghpvgcaialkaidvvmnegla
    envrrlaprfeerlkhiaerpnigeyrgigfmwaleavkdkasktpfdgnlsvseriant
    ctdlglicrplgqsvvlcppfilteaqmdemfdklekaldkvfaevaaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nuiB (B:)
    tvvvthgegpyivdvngrryldansglwnmvagfdhkglidaakaqyerfpgyhaffgrm
    sdqtvmlseklvevspfdsgrvfytnsgseandtmvkmlwflhaaegkpqkrkiltrwna
    yasmtgkpynsvfglplpgfvhltcphywrygeegeteeqfvarlareleetiqregadt
    iagffaepvmgaggvippakgyfqailpilrkydipvisdevicgfgrtgntwgcvtydf
    tpdaiissknltagffpmgavilgpelskrletaieaieefphgftasghpvgcaialka
    idvvmneglaenvrrlaprfeerlkhiaerpnigeyrgigfmwaleavkdkasktpfdgn
    lsvseriantctdlglicrplgqsvvlcppfilteaqmdemfdklekaldkvfaevaaa