PDB entry 3nug

View 3nug on RCSB PDB site
Description: Crystal structure of wild type tetrameric pyridoxal 4-dehydrogenase from Mesorhizobium loti
Class: oxidoreductase
Keywords: PYRIDOXAL, tPLDH, 4-PYRIDOXOLACTONE, SHORT CHAIN DEHYDROGENASE/REDUCTASE, OXIDOREDUCTASE
Deposited on 2010-07-06, released 2011-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-(acyl-carrier protein) reductase
    Species: Mesorhizobium loti [TaxId:381]
    Gene: mlr6807, pldh-t
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nuga_
  • Chain 'B':
    Compound: 3-oxoacyl-(acyl-carrier protein) reductase
    Species: Mesorhizobium loti [TaxId:381]
    Gene: mlr6807, pldh-t
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nugb_
  • Chain 'C':
    Compound: 3-oxoacyl-(acyl-carrier protein) reductase
    Species: Mesorhizobium loti [TaxId:381]
    Gene: mlr6807, pldh-t
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nugc_
  • Chain 'D':
    Compound: 3-oxoacyl-(acyl-carrier protein) reductase
    Species: Mesorhizobium loti [TaxId:381]
    Gene: mlr6807, pldh-t
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nugd_
  • Heterogens: NAD, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nugA (A:)
    terlagktalvtgaaqgigkaiaarlaadgatvivsdinaegakaaaasigkkaraiaad
    isdpgsvkalfaeiqaltggidilvnnasivpfvawddvdldhwrkiidvnltgtfivtr
    agtdqmraagkagrvisiasntffagtpnmaayvaakggvigftralatelgkynitana
    vtpgliesdgvkasphneafgfvemlqamkgkgqpehiadvvsflasddarwitgqtlnv
    dagmvrh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nugB (B:)
    terlagktalvtgaaqgigkaiaarlaadgatvivsdinaegakaaaasigkkaraiaad
    isdpgsvkalfaeiqaltggidilvnnasivpfvawddvdldhwrkiidvnltgtfivtr
    agtdqmraagkagrvisiasntffagtpnmaayvaakggvigftralatelgkynitana
    vtpgliesdgvkasphneafgfvemlqamkgkgqpehiadvvsflasddarwitgqtlnv
    dagmvrh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nugC (C:)
    terlagktalvtgaaqgigkaiaarlaadgatvivsdinaegakaaaasigkkaraiaad
    isdpgsvkalfaeiqaltggidilvnnasivpfvawddvdldhwrkiidvnltgtfivtr
    agtdqmraagkagrvisiasntffagtpnmaayvaakggvigftralatelgkynitana
    vtpgliesdgvkasphneafgfvemlqamkgkgqpehiadvvsflasddarwitgqtlnv
    dagmvrh
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nugD (D:)
    terlagktalvtgaaqgigkaiaarlaadgatvivsdinaegakaaaasigkkaraiaad
    isdpgsvkalfaeiqaltggidilvnnasivpfvawddvdldhwrkiidvnltgtfivtr
    agtdqmraagkagrvisiasntffagtpnmaayvaakggvigftralatelgkynitana
    vtpgliesdgvkasphneafgfvemlqamkgkgqpehiadvvsflasddarwitgqtlnv
    dagmvrh