PDB entry 3nuf

View 3nuf on RCSB PDB site
Description: crystal structure of a prd-containing transcription regulator (lsei_2718) from lactobacillus casei atcc 334 at 1.38 a resolution
Deposited on 2010-07-06, released 2010-09-08
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PRD-containing transcription regulator
    Species: Lactobacillus casei [TaxId:321967]
    Gene: LSEI_2718
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: PRD-containing transcription regulator
    Species: Lactobacillus casei [TaxId:321967]
    Gene: LSEI_2718
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, PEG, SO4, PG4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nufA (A:)
    gmtpldanvelptevkamieqssdaqaatalvnyviklaaaaeihftdlqlqvltnhlie
    mlgrsksgeqlpavdptmfaevsqksldladqvvqhighlevaekyvlsihfeaaqdki
    

    Sequence, based on observed residues (ATOM records):
    >3nufA (A:)
    mtpldanvelptevkamieqssdaqaatalvnyviklaaaaeihftdlqlqvltnhliem
    lgrsksgeqlpavdptmfaevsqksldladqvvqhighlevaekyvlsihfeaaqdki
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nufB (B:)
    gmtpldanvelptevkamieqssdaqaatalvnyviklaaaaeihftdlqlqvltnhlie
    mlgrsksgeqlpavdptmfaevsqksldladqvvqhighlevaekyvlsihfeaaqdki
    

    Sequence, based on observed residues (ATOM records):
    >3nufB (B:)
    nvelptevkamieqssdaqaatalvnyviklaaaaeihftdlqlqvltnhliemlgrsks
    geqlpavdptmfaevsqksldladqvvqhighlevaekyvlsihfeaaqdki