PDB entry 3nue

View 3nue on RCSB PDB site
Description: The structure of 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase from mycobacterium tuberculosis complexed with tryptophan
Class: transferase
Keywords: Mycobacterium tuberculosis, DAH7P synthase, Shikimate pathway, Aromatic biosynthesis, Evolutionary relationships, Transferase, TRP-bound, Augmented TIM-barrel structure
Deposited on 2010-07-06, released 2010-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.191
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase AroG
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv2178c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O53512 (2-463)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d3nuea1, d3nuea2
  • Chain 'B':
    Compound: Probable 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase AroG
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv2178c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O53512 (2-463)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d3nueb1, d3nueb2
  • Heterogens: MN, TRP, PO4, SO4, GOL, CE1, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nueA (A:)
    gamnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppv
    tvpseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygas
    mpvvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasa
    amnlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnl
    qtaeiyashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqv
    ianpvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatg
    hqviwqcdpmhgnthesstgfktrhfdrivdevqgffevhralgthpggihveitgenvt
    eclggaqdisetdlagryetacdprlntqqslelaflvaemlrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nueA (A:)
    gamnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppv
    tvpseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygas
    mpvvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasa
    amnlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnl
    qtaeiyashealvldyeramlrlsdgdgepqlfdlsahtvwigertrqidgahiafaqvi
    anpvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatgh
    qviwqcdpmhgnthgfktrhfdrivdevqgffevhralgthpggihveitgenvtlggaq
    dilagryetacdprlntqqslelaflvaemlrd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nueB (B:)
    gamnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppv
    tvpseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygas
    mpvvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasa
    amnlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnl
    qtaeiyashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqv
    ianpvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatg
    hqviwqcdpmhgnthesstgfktrhfdrivdevqgffevhralgthpggihveitgenvt
    eclggaqdisetdlagryetacdprlntqqslelaflvaemlrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nueB (B:)
    gamnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppv
    tvpseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygas
    mpvvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasa
    amnlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnl
    qtaeiyashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqv
    ianpvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatg
    hqviwqcdpmhgnfktrhfdrivdevqgffevhralgthpggihveitgenvtlagryea
    cdprlntqqslelaflvaemlrd