PDB entry 3nub

View 3nub on RCSB PDB site
Description: WbpE, an Aminotransferase from Pseudomonas aeruginosa Involved in O-antigen Assembly in Complex with Product as the External Aldimine
Class: transferase
Keywords: Domain-swapped Beta Hairpin, Aminotransferase, External Aldimine, PLP, PMP, UDP-GlcNAc(3NH2)A, Lipopolysaccharide, Pseudomonas aeruginosa, O-antigen, B-Band, TRANSFERASE
Deposited on 2010-07-06, released 2010-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-25, with a file datestamp of 2010-08-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.202
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminotransferase WbpE
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA3155, wbpE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nuba_
  • Chain 'B':
    Compound: Aminotransferase WbpE
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA3155, wbpE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nubb_
  • Heterogens: UD0, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nubA (A:)
    miefidlknqqarikdkidagiqrvlrhgqyilgpevteledrladfvgakyciscangt
    dalqivqmalgvgpgdevitpgftyvataetvallgakpvyvdidprtynldpqlleaai
    tprtkaiipvslygqcadfdainaiaskygipviedaaqsfgasykgkrscnlstvacts
    ffpskplgcygdggaiftnddelatairqiarhgqdrryhhirvgvnsrldtlqaaillp
    kleifeeeialrqkvaaeydlslkqvgigtpfievnnisvyaqytvrmdnresvqaslka
    agvptavhypiplnkqpavadekaklpvgdkaatqvmslpmhpyldtasikiicaaltn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nubA (A:)
    miefidlknqqarikdkidagiqrvlrhgqyilgpevteledrladfvgakyciscangt
    dalqivqmalgvgpgdevitpgftyvataetvallgakpvyvdidprtynldpqlleaai
    tprtkaiipvslygqcadfdainaiaskygipviedaaqsfgasykgkrscnlstvacts
    ffpskplgcygdggaiftnddelatairqiarhgqdrryhhirvgvnsrldtlqaaillp
    kleifeeeialrqkvaaeydlslkqvgigtpfievnnisvyaqytvrmdnresvqaslka
    agvptavhypiplnkqpavadekaklpvgdkaatqvmslpmhpyldtasikiicaalt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nubB (B:)
    miefidlknqqarikdkidagiqrvlrhgqyilgpevteledrladfvgakyciscangt
    dalqivqmalgvgpgdevitpgftyvataetvallgakpvyvdidprtynldpqlleaai
    tprtkaiipvslygqcadfdainaiaskygipviedaaqsfgasykgkrscnlstvacts
    ffpskplgcygdggaiftnddelatairqiarhgqdrryhhirvgvnsrldtlqaaillp
    kleifeeeialrqkvaaeydlslkqvgigtpfievnnisvyaqytvrmdnresvqaslka
    agvptavhypiplnkqpavadekaklpvgdkaatqvmslpmhpyldtasikiicaaltn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nubB (B:)
    miefidlknqqarikdkidagiqrvlrhgqyilgpevteledrladfvgakyciscangt
    dalqivqmalgvgpgdevitpgftyvataetvallgakpvyvdidprtynldpqlleaai
    tprtkaiipvslygqcadfdainaiaskygipviedaaqsfgasykgkrscnlstvacts
    ffpskplgcygdggaiftnddelatairqiarhgqdrryhhirvgvnsrldtlqaaillp
    kleifeeeialrqkvaaeydlslkqvgigtpfievnnisvyaqytvrmdnresvqaslka
    agvptavhypiplnkqpavadekaklpvgdkaatqvmslpmhpyldtasikiicaalt