PDB entry 3nu5

View 3nu5 on RCSB PDB site
Description: Crystal Structure of HIV-1 Protease Mutant I50V with Antiviral Drug Amprenavir
Class: hydrolase/hydrolase inhibitor
Keywords: enzyme inhibition, aspartic protease, HIV/AIDS, conformational change, Amprenavir, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-07-06, released 2010-08-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: XRAY
Resolution: 1.29 Å
R-factor: 0.155
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG, POL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366
      • engineered mutation (6)
      • engineered mutation (32)
      • engineered mutation (49)
      • engineered mutation (62)
      • engineered mutation (66)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d3nu5a_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG, POL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366 (0-98)
      • engineered mutation (6)
      • engineered mutation (32)
      • engineered mutation (49)
      • engineered mutation (62)
      • engineered mutation (66)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d3nu5b_
  • Heterogens: NA, CL, ACT, 478, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nu5A (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggvggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nu5B (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggvggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf