PDB entry 3nu1

View 3nu1 on RCSB PDB site
Description: Structure of holo form of a periplasmic heme binding protein
Class: metal transport
Keywords: transport protein, alpha beta protein, rigid helical backbone, substrate-bound, iron transport, heme transport, metal transport
Deposited on 2010-07-06, released 2010-10-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.198
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemin-binding periplasmic protein
    Species: Yersinia pestis [TaxId:360102]
    Gene: HMUT, Y0541, YPA_4001, YPO0281, YP_0436
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nu1a_
  • Chain 'B':
    Compound: Hemin-binding periplasmic protein
    Species: Yersinia pestis [TaxId:360102]
    Gene: HMUT, Y0541, YPA_4001, YPO0281, YP_0436
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nu1b_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nu1A (A:)
    aerivtiggdvteiayalgagdeivardstsqqpqaaqklpdvgymrtlnaegilamkpt
    mllvselaqpslvltqiassgvnvvtvpgqttpesvamkinavatalhqtekgqkliedy
    qqrlaavnktplpvkvlfvmshggltpmaagqntaadamiraaggsnamqgfsryrplsq
    egviasapdlllittdgvkalgsseniwklpgmaltpagkhkrllvvddmallgfgletp
    qvlaqlrekmeqmq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nu1B (B:)
    aerivtiggdvteiayalgagdeivardstsqqpqaaqklpdvgymrtlnaegilamkpt
    mllvselaqpslvltqiassgvnvvtvpgqttpesvamkinavatalhqtekgqkliedy
    qqrlaavnktplpvkvlfvmshggltpmaagqntaadamiraaggsnamqgfsryrplsq
    egviasapdlllittdgvkalgsseniwklpgmaltpagkhkrllvvddmallgfgletp
    qvlaqlrekmeqmq