PDB entry 3nty

View 3nty on RCSB PDB site
Description: Crystal structure of AKR1C1 in complex with NADP and 5-Phenyl,3-chlorosalicylic acid
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: Aldo-keto reductase, 20 alpha hydroxysteroid dehydrogenase, AKR1C1, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2010-07-06, released 2011-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-13, with a file datestamp of 2011-04-08.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.188
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aldo-keto reductase family 1 member C1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ntya_
  • Heterogens: NAP, 5P3, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ntyA (A:)
    mdskyqcvklndghfmpvlgfgtyapaevpkskaleatklaieagfrhidsahlynneeq
    vglairskiadgsvkredifytsklwcnshrpelvrpalerslknlqldyvdlylihfpv
    svkpgeevipkdengkilfdtvdlcatweavekckdaglaksigvsnfnrrqlemilnkp
    glkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpv
    lcalakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidgln
    rnvryltldifagppnypfsdey
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ntyA (A:)
    qcvklndghfmpvlgfgtyapaevpkskaleatklaieagfrhidsahlynneeqvglai
    rskiadgsvkredifytsklwcnshrpelvrpalerslknlqldyvdlylihfpvsvkpg
    eevipkdengkilfdtvdlcatweavekckdaglaksigvsnfnrrqlemilnkpglkyk
    pvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpvlcala
    kkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidglnrnvry
    ltldifagppnypfsdey