PDB entry 3ntx

View 3ntx on RCSB PDB site
Description: Crystal Structure of L-asparaginase I from Yersinia pestis
Class: hydrolase
Keywords: alpha-beta-alpha sandwich, CSGID, Structural Genomics, Structural Genomics of Infectious Diseases, Center for Structural Genomics of Infectious Diseases, HYDROLASE
Deposited on 2010-07-05, released 2010-08-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-04, with a file datestamp of 2010-07-30.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.156
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytoplasmic L-asparaginase I
    Species: Yersinia pestis [TaxId:214092]
    Gene: ansA, y2161, YPO2161, YP_1961
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CIH5
      • conflict (173)
    Domains in SCOPe 2.07: d3ntxa_
  • Chain 'B':
    Compound: Cytoplasmic L-asparaginase I
    Species: Yersinia pestis [TaxId:214092]
    Gene: ansA, y2161, YPO2161, YP_1961
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CIH5
      • conflict (173)
    Domains in SCOPe 2.07: d3ntxb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ntxA (A:)
    snamqkksiyvaytggtigmqrsdngyipvsghlqrqlalmpefhrpempdftiheyapl
    idssdmtpedwqhiandiqqnydlydgfvilhgtdtmaftasalsfmlenlakpviitgs
    qiplaelrsdgqtnllnalylaanhpvnevslffnnqlfrgnrttkahadgfdtfaspnl
    svlleagihirrqssvvsptsngplivhritpqpigvvtiypgisgavvrnfllqpvkal
    ilrsygvgnapqkaelldelknasdrgivvvnltqcisgsvnmggyatgnalaqagvisg
    fdmtveaaltklhyllsqslspneirqlmqqnlrgeltdtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ntxA (A:)
    qkksiyvaytggtigmqrsdngyipvsghlqrqlalmpefhrpempdftiheyaplidss
    dmtpedwqhiandiqqnydlydgfvilhgtdtmaftasalsfmlenlakpviitgsqipl
    aelrsdgqtnllnalylaanhpvnevslffnnqlfrgnrttkahadgfdtfaspnlsvll
    eagihirrqssvvsptsngplivhritpqpigvvtiypgisgavvrnfllqpvkalilrs
    ygvgnapqkaelldelknasdrgivvvnltqcisgsvnmgnalaqagvisgfdmtveaal
    tklhyllsqslspneirqlmqqnlrgeltdt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ntxB (B:)
    snamqkksiyvaytggtigmqrsdngyipvsghlqrqlalmpefhrpempdftiheyapl
    idssdmtpedwqhiandiqqnydlydgfvilhgtdtmaftasalsfmlenlakpviitgs
    qiplaelrsdgqtnllnalylaanhpvnevslffnnqlfrgnrttkahadgfdtfaspnl
    svlleagihirrqssvvsptsngplivhritpqpigvvtiypgisgavvrnfllqpvkal
    ilrsygvgnapqkaelldelknasdrgivvvnltqcisgsvnmggyatgnalaqagvisg
    fdmtveaaltklhyllsqslspneirqlmqqnlrgeltdtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ntxB (B:)
    qkksiyvaytggtigmqrsdngyipvsghlqrqlalmpefhrpempdftiheyaplidss
    dmtpedwqhiandiqqnydlydgfvilhgtdtmaftasalsfmlenlakpviitgsqipl
    aelrsdgqtnllnalylaanhpvnevslffnnqlfrgnrttkahadgfdtfaspnlsvll
    eagihirrqssvvsptsngplivhritpqpigvvtiypgisgavvrnfllqpvkalilrs
    ygvgnapqkaelldelknasdrgivvvnltqcisgsvnmgnalaqagvisgfdmtveaal
    tklhyllsqslspneirqlmqqnlrgeltdt